BLASTX nr result
ID: Paeonia22_contig00038831
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00038831 (228 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXJ89296.1| 60S ribosomal protein L30 [Capronia epimyces CBS ... 73 5e-11 emb|CCU77093.1| 60S ribosomal protein L30 [Blumeria graminis f. ... 73 5e-11 gb|EPQ63958.1| Protein component of the large (60S) ribosomal su... 73 5e-11 gb|EON63881.1| 60S ribosomal protein L30 [Coniosporium apollinis... 73 5e-11 gb|EKG17776.1| Ribosomal protein L30e [Macrophomina phaseolina MS6] 73 5e-11 ref|XP_001826354.1| 60S ribosomal protein L30 [Aspergillus oryza... 72 8e-11 gb|ERF77046.1| 60S ribosomal protein L30-1 [Endocarpon pusillum ... 71 1e-10 ref|XP_007296807.1| 60S ribosomal protein L10 [Marssonina brunne... 71 1e-10 dbj|GAD99215.1| 60S ribosomal protein L30 [Byssochlamys spectabi... 71 2e-10 gb|EHL01065.1| putative 60S ribosomal protein L30 [Glarea lozoye... 71 2e-10 ref|XP_001395556.1| 60S ribosomal protein L30 [Aspergillus niger... 71 2e-10 ref|XP_001218480.1| 60S ribosomal protein L30 [Aspergillus terre... 71 2e-10 gb|EXJ72691.1| 60S ribosomal protein L30 [Cladophialophora psamm... 70 2e-10 gb|ETI27964.1| 60S ribosomal protein L30 [Cladophialophora carri... 70 2e-10 gb|ESZ91510.1| hypothetical protein SBOR_8108 [Sclerotinia borea... 70 2e-10 gb|EHY57930.1| 60S ribosomal protein L30 [Exophiala dermatitidis... 70 2e-10 ref|XP_001594073.1| 60S ribosomal protein L30 [Sclerotinia scler... 70 2e-10 ref|XP_001551813.1| 60S ribosomal protein L30 [Botryotinia fucke... 70 2e-10 ref|XP_003845742.1| similar to 60S ribosomal protein L30 [Leptos... 70 3e-10 ref|XP_002623961.1| 60S ribosomal protein L30 [Ajellomyces derma... 70 3e-10 >gb|EXJ89296.1| 60S ribosomal protein L30 [Capronia epimyces CBS 606.96] Length = 108 Score = 72.8 bits (177), Expect = 5e-11 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 115 DSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVIIA 2 DSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVIIA Sbjct: 11 DSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVIIA 48 >emb|CCU77093.1| 60S ribosomal protein L30 [Blumeria graminis f. sp. hordei DH14] Length = 110 Score = 72.8 bits (177), Expect = 5e-11 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 115 DSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVIIA 2 DSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVIIA Sbjct: 12 DSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVIIA 49 >gb|EPQ63958.1| Protein component of the large (60S) ribosomal subunit [Blumeria graminis f. sp. tritici 96224] Length = 110 Score = 72.8 bits (177), Expect = 5e-11 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 115 DSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVIIA 2 DSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVIIA Sbjct: 12 DSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVIIA 49 >gb|EON63881.1| 60S ribosomal protein L30 [Coniosporium apollinis CBS 100218] Length = 109 Score = 72.8 bits (177), Expect = 5e-11 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 115 DSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVIIA 2 DSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVIIA Sbjct: 11 DSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVIIA 48 >gb|EKG17776.1| Ribosomal protein L30e [Macrophomina phaseolina MS6] Length = 110 Score = 72.8 bits (177), Expect = 5e-11 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 115 DSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVIIA 2 DSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVIIA Sbjct: 11 DSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVIIA 48 >ref|XP_001826354.1| 60S ribosomal protein L30 [Aspergillus oryzae RIB40] gi|238493609|ref|XP_002378041.1| 60S ribosomal protein L30 [Aspergillus flavus NRRL3357] gi|83775098|dbj|BAE65221.1| unnamed protein product [Aspergillus oryzae RIB40] gi|220696535|gb|EED52877.1| 60S ribosomal protein L30, putative [Aspergillus flavus NRRL3357] gi|391869425|gb|EIT78623.1| 60S ribosomal protein [Aspergillus oryzae 3.042] Length = 106 Score = 72.0 bits (175), Expect = 8e-11 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -3 Query: 115 DSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVIIA 2 DSINSRLALVMKSGKVTLGYKST+KTLRSGKAKLVIIA Sbjct: 10 DSINSRLALVMKSGKVTLGYKSTIKTLRSGKAKLVIIA 47 >gb|ERF77046.1| 60S ribosomal protein L30-1 [Endocarpon pusillum Z07020] Length = 99 Score = 71.2 bits (173), Expect = 1e-10 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -3 Query: 115 DSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVIIA 2 DSINSRLALVMKSGKVTLGYKSTLK+LRSGKAKLVIIA Sbjct: 11 DSINSRLALVMKSGKVTLGYKSTLKSLRSGKAKLVIIA 48 >ref|XP_007296807.1| 60S ribosomal protein L10 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406859902|gb|EKD12964.1| 60S ribosomal protein L10 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 335 Score = 71.2 bits (173), Expect = 1e-10 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = -3 Query: 115 DSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVIIA 2 D INSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVIIA Sbjct: 12 DGINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVIIA 49 >dbj|GAD99215.1| 60S ribosomal protein L30 [Byssochlamys spectabilis No. 5] Length = 108 Score = 70.9 bits (172), Expect = 2e-10 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -3 Query: 115 DSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVIIA 2 D+INSRLALVMKSGKVTLGYKST+KTLRSGKAKLVIIA Sbjct: 11 DNINSRLALVMKSGKVTLGYKSTIKTLRSGKAKLVIIA 48 >gb|EHL01065.1| putative 60S ribosomal protein L30 [Glarea lozoyensis 74030] gi|512206497|gb|EPE35316.1| L30e-like protein [Glarea lozoyensis ATCC 20868] Length = 110 Score = 70.9 bits (172), Expect = 2e-10 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = -3 Query: 115 DSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVIIA 2 DSINSRLALVMKSGKV LGYKSTLKTLRSGKAKLVIIA Sbjct: 12 DSINSRLALVMKSGKVVLGYKSTLKTLRSGKAKLVIIA 49 >ref|XP_001395556.1| 60S ribosomal protein L30 [Aspergillus niger CBS 513.88] gi|134080274|emb|CAK97177.1| unnamed protein product [Aspergillus niger] gi|350636901|gb|EHA25259.1| hypothetical protein ASPNIDRAFT_56702 [Aspergillus niger ATCC 1015] gi|358369886|dbj|GAA86499.1| 60S ribosomal protein L30-2 [Aspergillus kawachii IFO 4308] Length = 106 Score = 70.9 bits (172), Expect = 2e-10 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -3 Query: 115 DSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVIIA 2 D+INSRLALVMKSGKVTLGYKST+KTLRSGKAKLVIIA Sbjct: 10 DTINSRLALVMKSGKVTLGYKSTIKTLRSGKAKLVIIA 47 >ref|XP_001218480.1| 60S ribosomal protein L30 [Aspergillus terreus NIH2624] gi|114188349|gb|EAU30049.1| 60S ribosomal protein L30-2 [Aspergillus terreus NIH2624] Length = 106 Score = 70.9 bits (172), Expect = 2e-10 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -3 Query: 115 DSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVIIA 2 D+INSRLALVMKSGKVTLGYKST+KTLRSGKAKLVIIA Sbjct: 10 DTINSRLALVMKSGKVTLGYKSTIKTLRSGKAKLVIIA 47 >gb|EXJ72691.1| 60S ribosomal protein L30 [Cladophialophora psammophila CBS 110553] Length = 108 Score = 70.5 bits (171), Expect = 2e-10 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = -3 Query: 115 DSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVIIA 2 DSINSRLALVMKSGKVTLGYKSTLK LRSGKAKLVIIA Sbjct: 11 DSINSRLALVMKSGKVTLGYKSTLKCLRSGKAKLVIIA 48 >gb|ETI27964.1| 60S ribosomal protein L30 [Cladophialophora carrionii CBS 160.54] Length = 108 Score = 70.5 bits (171), Expect = 2e-10 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = -3 Query: 115 DSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVIIA 2 DSINSRLALVMKSGKVTLGYKSTLK LRSGKAKLVIIA Sbjct: 11 DSINSRLALVMKSGKVTLGYKSTLKCLRSGKAKLVIIA 48 >gb|ESZ91510.1| hypothetical protein SBOR_8108 [Sclerotinia borealis F-4157] Length = 111 Score = 70.5 bits (171), Expect = 2e-10 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = -3 Query: 115 DSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVIIA 2 DSINSRLALVMKSGKVTLGYKSTLK LRSGKAKLVIIA Sbjct: 13 DSINSRLALVMKSGKVTLGYKSTLKQLRSGKAKLVIIA 50 >gb|EHY57930.1| 60S ribosomal protein L30 [Exophiala dermatitidis NIH/UT8656] gi|590020170|gb|EXJ95367.1| 60S ribosomal protein L30 [Capronia coronata CBS 617.96] Length = 108 Score = 70.5 bits (171), Expect = 2e-10 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = -3 Query: 115 DSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVIIA 2 DSINSRLALVMKSGKVTLGYKSTLK LRSGKAKLVIIA Sbjct: 11 DSINSRLALVMKSGKVTLGYKSTLKCLRSGKAKLVIIA 48 >ref|XP_001594073.1| 60S ribosomal protein L30 [Sclerotinia sclerotiorum 1980 UF-70] gi|154703285|gb|EDO03024.1| hypothetical protein SS1G_05501 [Sclerotinia sclerotiorum 1980 UF-70] Length = 128 Score = 70.5 bits (171), Expect = 2e-10 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = -3 Query: 115 DSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVIIA 2 DSINSRLALVMKSGKVTLGYKSTLK LRSGKAKLVIIA Sbjct: 30 DSINSRLALVMKSGKVTLGYKSTLKQLRSGKAKLVIIA 67 >ref|XP_001551813.1| 60S ribosomal protein L30 [Botryotinia fuckeliana B05.10] gi|347836247|emb|CCD50819.1| similar to 60S ribosomal protein L30 [Botryotinia fuckeliana T4] gi|472238753|gb|EMR83602.1| putative 60s ribosomal protein l30 protein [Botryotinia fuckeliana BcDW1] Length = 111 Score = 70.5 bits (171), Expect = 2e-10 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = -3 Query: 115 DSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVIIA 2 DSINSRLALVMKSGKVTLGYKSTLK LRSGKAKLVIIA Sbjct: 13 DSINSRLALVMKSGKVTLGYKSTLKQLRSGKAKLVIIA 50 >ref|XP_003845742.1| similar to 60S ribosomal protein L30 [Leptosphaeria maculans JN3] gi|312222323|emb|CBY02263.1| similar to 60S ribosomal protein L30 [Leptosphaeria maculans JN3] Length = 110 Score = 70.1 bits (170), Expect = 3e-10 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -3 Query: 115 DSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVIIA 2 DSINSRLALVMKSGKVTLGYKSTLK+LR+GKAKLVIIA Sbjct: 11 DSINSRLALVMKSGKVTLGYKSTLKSLRTGKAKLVIIA 48 >ref|XP_002623961.1| 60S ribosomal protein L30 [Ajellomyces dermatitidis SLH14081] gi|239587833|gb|EEQ70476.1| cytosolic large ribosomal subunit protein L30 [Ajellomyces dermatitidis SLH14081] gi|239610679|gb|EEQ87666.1| cytosolic large ribosomal subunit protein L30 [Ajellomyces dermatitidis ER-3] gi|327348885|gb|EGE77742.1| ribosomal protein L30 [Ajellomyces dermatitidis ATCC 18188] gi|531987432|gb|EQL38019.1| 60S ribosomal protein L30 [Ajellomyces dermatitidis ATCC 26199] Length = 109 Score = 70.1 bits (170), Expect = 3e-10 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -3 Query: 115 DSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVIIA 2 D+INSRLALVMKSGKVTLGYKSTLK+LRSGKAKLVIIA Sbjct: 11 DNINSRLALVMKSGKVTLGYKSTLKSLRSGKAKLVIIA 48