BLASTX nr result
ID: Paeonia22_contig00038683
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00038683 (296 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514707.1| hypothetical protein RCOM_1470750 [Ricinus c... 66 4e-09 >ref|XP_002514707.1| hypothetical protein RCOM_1470750 [Ricinus communis] gi|223546311|gb|EEF47813.1| hypothetical protein RCOM_1470750 [Ricinus communis] Length = 925 Score = 66.2 bits (160), Expect = 4e-09 Identities = 35/85 (41%), Positives = 49/85 (57%) Frame = +2 Query: 8 SFSKRSTCLVDLNEPFQFQEATSSSSVDFPGPILSYQEIPHYDLSGKISTDFQNLSKDNL 187 SFS R+ L DLNEP + +E T S DF P+ +EIP +DLSG+ +DFQ K+ + Sbjct: 255 SFSMRTKLLADLNEPIKLEEETDPESNDFLSPVSDPREIPCHDLSGEKFSDFQFQPKETI 314 Query: 188 LFTQTSSDLEACSNFVDMVKERERK 262 +QT D E SN + + K R+ Sbjct: 315 QISQTVGDPEPFSNVLHLEKNETRR 339