BLASTX nr result
ID: Paeonia22_contig00038563
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00038563 (487 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN69058.1| hypothetical protein VITISV_022968 [Vitis vinifera] 40 5e-06 >emb|CAN69058.1| hypothetical protein VITISV_022968 [Vitis vinifera] Length = 830 Score = 40.0 bits (92), Expect(2) = 5e-06 Identities = 20/48 (41%), Positives = 29/48 (60%) Frame = -2 Query: 144 SHLDSCTN*SDLEVSRILHLEDISNRLPNVLMMHTY*QKIR*ARTNVP 1 +HLD TN +LEV RI+HL++++N+LPN + K TN P Sbjct: 334 THLDPHTNQCELEVQRIIHLQNLANQLPNAFIDTKKVTKSHIPATNTP 381 Score = 35.8 bits (81), Expect(2) = 5e-06 Identities = 19/36 (52%), Positives = 23/36 (63%) Frame = -1 Query: 268 DLFTARFT*IIFDELIIPPLGGEISIIVNE*REVMW 161 D+FTARF F+E + P LGGE S I E RE+ W Sbjct: 294 DIFTARFADCHFNESVFPSLGGEKS-IPEERREISW 328