BLASTX nr result
ID: Paeonia22_contig00038360
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00038360 (324 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007297620.1| 60S ribosomal protein L20 [Marssonina brunne... 80 3e-13 gb|EPE30763.1| 60S ribosomal protein L20 [Glarea lozoyensis ATCC... 71 1e-10 gb|ELR06554.1| 60S ribosomal protein L20 [Pseudogymnoascus destr... 71 1e-10 gb|EHK96283.1| putative 60S ribosomal protein L20-B [Glarea lozo... 71 1e-10 ref|XP_003071410.1| 60S ribosomal protein L20 [Coccidioides posa... 69 5e-10 ref|XP_001245490.1| 60S ribosomal protein L20 [Coccidioides immi... 69 5e-10 gb|EOA91377.1| hypothetical protein SETTUDRAFT_29919 [Setosphaer... 69 9e-10 ref|XP_003297118.1| 60S ribosomal protein L20 [Pyrenophora teres... 69 9e-10 ref|XP_001935145.1| 60S ribosomal protein L20 [Pyrenophora triti... 69 9e-10 gb|EYE94501.1| ribosomal protein L18ae [Aspergillus ruber CBS 13... 67 2e-09 emb|CCU81505.1| 60S ribosomal protein L20 [Blumeria graminis f. ... 67 2e-09 gb|EPQ64215.1| Protein component of the large (60S) ribosomal su... 67 2e-09 ref|XP_007580415.1| putative 60s ribosomal protein l20 protein [... 67 3e-09 ref|XP_003841410.1| similar to 60S ribosomal protein L18a [Lepto... 67 3e-09 gb|EUC46000.1| hypothetical protein COCMIDRAFT_94025 [Bipolaris ... 67 3e-09 gb|EUC27801.1| hypothetical protein COCCADRAFT_9694 [Bipolaris z... 67 3e-09 gb|EMD87012.1| hypothetical protein COCHEDRAFT_1227999 [Bipolari... 67 3e-09 gb|EMD59734.1| hypothetical protein COCSADRAFT_203472 [Bipolaris... 67 3e-09 emb|CCE34709.1| probable 60S large subunit ribosomal protein [Cl... 66 4e-09 gb|EZF34867.1| 60S ribosomal protein L20 [Trichophyton interdigi... 66 6e-09 >ref|XP_007297620.1| 60S ribosomal protein L20 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406859021|gb|EKD12094.1| 60S ribosomal protein L20 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 242 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -2 Query: 323 RPYIKQLLTKDLKFPLPHRVSKATGKKIFSGSRPSTFY 210 RPYIKQLLTKDLKFPLPHRVSK+TGKKIFSGSRPSTFY Sbjct: 205 RPYIKQLLTKDLKFPLPHRVSKSTGKKIFSGSRPSTFY 242 >gb|EPE30763.1| 60S ribosomal protein L20 [Glarea lozoyensis ATCC 20868] Length = 184 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = -2 Query: 323 RPYIKQLLTKDLKFPLPHRVSKATGKKIFSGSRPSTFY 210 RPYIKQLLTK+LKFPLPHRVSKA G KIF G RPSTFY Sbjct: 147 RPYIKQLLTKNLKFPLPHRVSKAAGTKIFVGKRPSTFY 184 >gb|ELR06554.1| 60S ribosomal protein L20 [Pseudogymnoascus destructans 20631-21] Length = 174 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -2 Query: 323 RPYIKQLLTKDLKFPLPHRVSKATGKKIFSGSRPSTFY 210 RPYIKQLLTKDLKFPLPHRVSKA G K+F+ RPSTFY Sbjct: 137 RPYIKQLLTKDLKFPLPHRVSKAAGTKLFTSKRPSTFY 174 >gb|EHK96283.1| putative 60S ribosomal protein L20-B [Glarea lozoyensis 74030] Length = 231 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = -2 Query: 323 RPYIKQLLTKDLKFPLPHRVSKATGKKIFSGSRPSTFY 210 RPYIKQLLTK+LKFPLPHRVSKA G KIF G RPSTFY Sbjct: 194 RPYIKQLLTKNLKFPLPHRVSKAAGTKIFVGKRPSTFY 231 >ref|XP_003071410.1| 60S ribosomal protein L20 [Coccidioides posadasii C735 delta SOWgp] gi|240111112|gb|EER29265.1| 60S ribosomal protein L20, putative [Coccidioides posadasii C735 delta SOWgp] Length = 148 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -2 Query: 323 RPYIKQLLTKDLKFPLPHRVSKATGKKIFSGSRPSTF 213 RPYIKQLLTKDLKFPLPHRVSK GK++F+ SRPSTF Sbjct: 111 RPYIKQLLTKDLKFPLPHRVSKPQGKRVFAASRPSTF 147 >ref|XP_001245490.1| 60S ribosomal protein L20 [Coccidioides immitis RS] gi|320032825|gb|EFW14775.1| 60S ribosomal protein L18A [Coccidioides posadasii str. Silveira] gi|392868384|gb|EAS34164.2| 60S ribosomal protein L20 [Coccidioides immitis RS] Length = 174 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -2 Query: 323 RPYIKQLLTKDLKFPLPHRVSKATGKKIFSGSRPSTF 213 RPYIKQLLTKDLKFPLPHRVSK GK++F+ SRPSTF Sbjct: 137 RPYIKQLLTKDLKFPLPHRVSKPQGKRVFAASRPSTF 173 >gb|EOA91377.1| hypothetical protein SETTUDRAFT_29919 [Setosphaeria turcica Et28A] Length = 173 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = -2 Query: 323 RPYIKQLLTKDLKFPLPHRVSKATGKKIFSGSRPSTFY 210 RPYIKQLLTK+LKFPLPHR++K GKK+FS +RPSTF+ Sbjct: 136 RPYIKQLLTKNLKFPLPHRINKKAGKKVFSANRPSTFF 173 >ref|XP_003297118.1| 60S ribosomal protein L20 [Pyrenophora teres f. teres 0-1] gi|311330357|gb|EFQ94776.1| hypothetical protein PTT_07431 [Pyrenophora teres f. teres 0-1] Length = 175 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = -2 Query: 323 RPYIKQLLTKDLKFPLPHRVSKATGKKIFSGSRPSTFY 210 RPYIKQLLTK+LKFPLPHR++K GKK+FS +RPSTF+ Sbjct: 138 RPYIKQLLTKNLKFPLPHRINKKAGKKVFSATRPSTFF 175 >ref|XP_001935145.1| 60S ribosomal protein L20 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187981093|gb|EDU47719.1| 60S ribosomal protein L18ae [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 174 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = -2 Query: 323 RPYIKQLLTKDLKFPLPHRVSKATGKKIFSGSRPSTFY 210 RPYIKQLLTK+LKFPLPHR++K GKK+FS +RPSTF+ Sbjct: 137 RPYIKQLLTKNLKFPLPHRINKKAGKKVFSATRPSTFF 174 >gb|EYE94501.1| ribosomal protein L18ae [Aspergillus ruber CBS 135680] Length = 174 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -2 Query: 323 RPYIKQLLTKDLKFPLPHRVSKATGKKIFSGSRPSTF 213 RPYIKQLLTKDLKFPLPHR +K GKKIF+ SRPSTF Sbjct: 137 RPYIKQLLTKDLKFPLPHRAAKPAGKKIFAYSRPSTF 173 >emb|CCU81505.1| 60S ribosomal protein L20 [Blumeria graminis f. sp. hordei DH14] Length = 191 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -2 Query: 323 RPYIKQLLTKDLKFPLPHRVSKATGKKIFSGSRPSTFY 210 RPYIKQLLTKDLKFPLPHR++K+ KIF+ RPSTFY Sbjct: 154 RPYIKQLLTKDLKFPLPHRIAKSASSKIFANKRPSTFY 191 >gb|EPQ64215.1| Protein component of the large (60S) ribosomal subunit [Blumeria graminis f. sp. tritici 96224] Length = 177 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -2 Query: 323 RPYIKQLLTKDLKFPLPHRVSKATGKKIFSGSRPSTFY 210 RPYIKQLLTKDLKFPLPHR++K+ KIF+ RPSTFY Sbjct: 140 RPYIKQLLTKDLKFPLPHRIAKSASSKIFANKRPSTFY 177 >ref|XP_007580415.1| putative 60s ribosomal protein l20 protein [Neofusicoccum parvum UCRNP2] gi|485928268|gb|EOD52004.1| putative 60s ribosomal protein l20 protein [Neofusicoccum parvum UCRNP2] Length = 174 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -2 Query: 323 RPYIKQLLTKDLKFPLPHRVSKATGKKIFSGSRPSTFY 210 RPYIKQ+L KDLKFPLPHRV+K T KKIF+ +RPSTF+ Sbjct: 137 RPYIKQVLAKDLKFPLPHRVNKTTSKKIFTANRPSTFF 174 >ref|XP_003841410.1| similar to 60S ribosomal protein L18a [Leptosphaeria maculans JN3] gi|312217984|emb|CBX97931.1| similar to 60S ribosomal protein L18a [Leptosphaeria maculans JN3] Length = 182 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -2 Query: 323 RPYIKQLLTKDLKFPLPHRVSKATGKKIFSGSRPSTFY 210 RPYIKQLL K+LKFPLPHR++K GKKIFS +RPSTF+ Sbjct: 145 RPYIKQLLVKNLKFPLPHRINKKAGKKIFSSTRPSTFF 182 >gb|EUC46000.1| hypothetical protein COCMIDRAFT_94025 [Bipolaris oryzae ATCC 44560] Length = 190 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -2 Query: 323 RPYIKQLLTKDLKFPLPHRVSKATGKKIFSGSRPSTFY 210 RPYIKQLLTK+LKFPLPHR++K GKK+F+ RPSTF+ Sbjct: 153 RPYIKQLLTKNLKFPLPHRINKKAGKKVFAAHRPSTFF 190 >gb|EUC27801.1| hypothetical protein COCCADRAFT_9694 [Bipolaris zeicola 26-R-13] gi|578485853|gb|EUN23340.1| hypothetical protein COCVIDRAFT_29773 [Bipolaris victoriae FI3] Length = 191 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -2 Query: 323 RPYIKQLLTKDLKFPLPHRVSKATGKKIFSGSRPSTFY 210 RPYIKQLLTK+LKFPLPHR++K GKK+F+ RPSTF+ Sbjct: 154 RPYIKQLLTKNLKFPLPHRINKKAGKKVFAAHRPSTFF 191 >gb|EMD87012.1| hypothetical protein COCHEDRAFT_1227999 [Bipolaris maydis C5] gi|477586910|gb|ENI03993.1| hypothetical protein COCC4DRAFT_198673 [Bipolaris maydis ATCC 48331] Length = 205 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -2 Query: 323 RPYIKQLLTKDLKFPLPHRVSKATGKKIFSGSRPSTFY 210 RPYIKQLLTK+LKFPLPHR++K GKK+F+ RPSTF+ Sbjct: 168 RPYIKQLLTKNLKFPLPHRINKKAGKKVFAAHRPSTFF 205 >gb|EMD59734.1| hypothetical protein COCSADRAFT_203472 [Bipolaris sorokiniana ND90Pr] Length = 190 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -2 Query: 323 RPYIKQLLTKDLKFPLPHRVSKATGKKIFSGSRPSTFY 210 RPYIKQLLTK+LKFPLPHR++K GKK+F+ RPSTF+ Sbjct: 153 RPYIKQLLTKNLKFPLPHRINKKAGKKVFAAHRPSTFF 190 >emb|CCE34709.1| probable 60S large subunit ribosomal protein [Claviceps purpurea 20.1] Length = 176 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -2 Query: 323 RPYIKQLLTKDLKFPLPHRVSKATGKKIFSGSRPSTF 213 RPYIKQLLTKDL FPLPHR+SK + KK+FS RPSTF Sbjct: 139 RPYIKQLLTKDLSFPLPHRISKVSSKKLFSAKRPSTF 175 >gb|EZF34867.1| 60S ribosomal protein L20 [Trichophyton interdigitale H6] Length = 174 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -2 Query: 323 RPYIKQLLTKDLKFPLPHRVSKATGKKIFSGSRPSTF 213 RPYIKQLL+K LKFPLPHRV+K T KK+FS SRPSTF Sbjct: 137 RPYIKQLLSKGLKFPLPHRVAKPTNKKLFSASRPSTF 173