BLASTX nr result
ID: Paeonia22_contig00038213
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00038213 (228 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006582703.1| PREDICTED: uncharacterized protein LOC102669... 57 2e-10 ref|XP_006590045.1| PREDICTED: uncharacterized protein LOC102666... 57 2e-10 ref|XP_006599968.1| PREDICTED: uncharacterized protein LOC102668... 57 2e-10 gb|ACN78972.1| truncated copia-type polyprotein [Glycine max] gi... 57 2e-10 ref|XP_006588234.1| PREDICTED: uncharacterized protein LOC102669... 57 2e-10 ref|XP_006606791.1| PREDICTED: uncharacterized protein LOC102660... 55 4e-10 ref|XP_006598587.1| PREDICTED: uncharacterized protein LOC102670... 55 7e-10 ref|XP_006596781.1| PREDICTED: uncharacterized protein LOC102662... 55 7e-10 ref|XP_006580654.1| PREDICTED: uncharacterized protein LOC102664... 55 7e-10 ref|XP_006575849.1| PREDICTED: uncharacterized protein LOC102667... 53 2e-09 ref|XP_006577639.1| PREDICTED: uncharacterized protein LOC102659... 54 3e-09 ref|XP_006601509.1| PREDICTED: uncharacterized protein LOC102663... 57 4e-09 gb|AAG60117.1|AC073555_1 copia-type polyprotein, putative [Arabi... 50 2e-08 emb|CAB71063.1| copia-type polyprotein [Arabidopsis thaliana] 50 2e-08 gb|AAD50001.1|AC007259_14 Hypothetical protein [Arabidopsis thal... 50 2e-08 gb|AAG50698.1|AC079604_5 copia-type polyprotein, putative [Arabi... 50 2e-08 emb|CAB75469.1| copia-type reverse transcriptase-like protein [A... 50 2e-08 emb|CAA69271.1| lectin receptor kinase [Arabidopsis thaliana] 50 2e-08 emb|CAN71055.1| hypothetical protein VITISV_003722 [Vitis vinifera] 60 5e-08 gb|AAF16534.1|AC013482_8 T26F17.17 [Arabidopsis thaliana] 50 6e-08 >ref|XP_006582703.1| PREDICTED: uncharacterized protein LOC102669793 [Glycine max] Length = 480 Score = 56.6 bits (135), Expect(2) = 2e-10 Identities = 27/41 (65%), Positives = 36/41 (87%) Frame = -2 Query: 125 ISDYFPQVQAIVNQLRRNGEDIEDVLVVEKILRSLVSRFDY 3 ISD+ +V AIVNQ++R GE++EDV VVEKILRSL+++FDY Sbjct: 132 ISDFGNKVLAIVNQMKRYGENMEDVRVVEKILRSLIAKFDY 172 Score = 34.3 bits (77), Expect(2) = 2e-10 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = -1 Query: 201 SFGGAKKVRKVHFQTLRGEFESLHI 127 S G KV+KV QTLR EFESLH+ Sbjct: 102 SLEGVDKVKKVRLQTLRREFESLHM 126 >ref|XP_006590045.1| PREDICTED: uncharacterized protein LOC102666268 [Glycine max] Length = 368 Score = 56.6 bits (135), Expect(2) = 2e-10 Identities = 27/41 (65%), Positives = 36/41 (87%) Frame = -2 Query: 125 ISDYFPQVQAIVNQLRRNGEDIEDVLVVEKILRSLVSRFDY 3 ISD+ +V AIVNQ++R GE++EDV VVEKILRSL+++FDY Sbjct: 132 ISDFGNKVLAIVNQMKRYGENMEDVRVVEKILRSLIAKFDY 172 Score = 34.3 bits (77), Expect(2) = 2e-10 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = -1 Query: 201 SFGGAKKVRKVHFQTLRGEFESLHI 127 S G KV+KV QTLR EFESLH+ Sbjct: 102 SLEGVDKVKKVRLQTLRREFESLHM 126 >ref|XP_006599968.1| PREDICTED: uncharacterized protein LOC102668860 [Glycine max] Length = 247 Score = 56.6 bits (135), Expect(2) = 2e-10 Identities = 27/41 (65%), Positives = 36/41 (87%) Frame = -2 Query: 125 ISDYFPQVQAIVNQLRRNGEDIEDVLVVEKILRSLVSRFDY 3 ISD+ +V AIVNQ++R GE++EDV VVEKILRSL+++FDY Sbjct: 132 ISDFGNKVLAIVNQMKRYGENMEDVRVVEKILRSLITKFDY 172 Score = 34.3 bits (77), Expect(2) = 2e-10 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = -1 Query: 201 SFGGAKKVRKVHFQTLRGEFESLHI 127 S G KV+KV QTLR EFESLH+ Sbjct: 102 SLEGVDKVKKVRLQTLRREFESLHM 126 >gb|ACN78972.1| truncated copia-type polyprotein [Glycine max] gi|225016156|gb|ACN78979.1| truncated copia-type polyprotein [Glycine max] Length = 212 Score = 56.6 bits (135), Expect(2) = 2e-10 Identities = 27/41 (65%), Positives = 36/41 (87%) Frame = -2 Query: 125 ISDYFPQVQAIVNQLRRNGEDIEDVLVVEKILRSLVSRFDY 3 ISD+ +V AIVNQ++R GE++EDV VVEKILRSL+++FDY Sbjct: 97 ISDFGNKVLAIVNQMKRYGENMEDVRVVEKILRSLIAKFDY 137 Score = 34.3 bits (77), Expect(2) = 2e-10 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = -1 Query: 201 SFGGAKKVRKVHFQTLRGEFESLHI 127 S G KV+KV QTLR EFESLH+ Sbjct: 67 SLEGVDKVKKVRLQTLRREFESLHM 91 >ref|XP_006588234.1| PREDICTED: uncharacterized protein LOC102669390 [Glycine max] Length = 189 Score = 56.6 bits (135), Expect(2) = 2e-10 Identities = 27/41 (65%), Positives = 36/41 (87%) Frame = -2 Query: 125 ISDYFPQVQAIVNQLRRNGEDIEDVLVVEKILRSLVSRFDY 3 ISD+ +V AIVNQ++R GE++EDV VVEKILRSL+++FDY Sbjct: 132 ISDFGNKVLAIVNQMKRYGENMEDVRVVEKILRSLIAKFDY 172 Score = 34.3 bits (77), Expect(2) = 2e-10 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = -1 Query: 201 SFGGAKKVRKVHFQTLRGEFESLHI 127 S G KV+KV QTLR EFESLH+ Sbjct: 102 SLEGVDKVKKVRLQTLRREFESLHM 126 >ref|XP_006606791.1| PREDICTED: uncharacterized protein LOC102660173 [Glycine max] Length = 265 Score = 55.5 bits (132), Expect(2) = 4e-10 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = -2 Query: 125 ISDYFPQVQAIVNQLRRNGEDIEDVLVVEKILRSLVSRFDY 3 ISD+ +V AIVNQ++R GE++EDV VVEKILRSL+ +FDY Sbjct: 132 ISDFGNKVLAIVNQMKRYGENMEDVRVVEKILRSLIVKFDY 172 Score = 34.3 bits (77), Expect(2) = 4e-10 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = -1 Query: 201 SFGGAKKVRKVHFQTLRGEFESLHI 127 S G KV+KV QTLR EFESLH+ Sbjct: 102 SLEGVDKVKKVRLQTLRREFESLHM 126 >ref|XP_006598587.1| PREDICTED: uncharacterized protein LOC102670235 [Glycine max] Length = 372 Score = 55.1 bits (131), Expect(2) = 7e-10 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = -2 Query: 125 ISDYFPQVQAIVNQLRRNGEDIEDVLVVEKILRSLVSRFDY 3 ISD+ +V IVNQ++R GE++EDV VVEKILRSL+++FDY Sbjct: 132 ISDFGNKVLTIVNQMKRYGENMEDVRVVEKILRSLIAKFDY 172 Score = 33.9 bits (76), Expect(2) = 7e-10 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = -1 Query: 201 SFGGAKKVRKVHFQTLRGEFESLHI 127 S G KV+KV QTLR EFESLH+ Sbjct: 102 SLNGVDKVKKVCLQTLRREFESLHM 126 >ref|XP_006596781.1| PREDICTED: uncharacterized protein LOC102662324 [Glycine max] Length = 249 Score = 54.7 bits (130), Expect(2) = 7e-10 Identities = 26/41 (63%), Positives = 36/41 (87%) Frame = -2 Query: 125 ISDYFPQVQAIVNQLRRNGEDIEDVLVVEKILRSLVSRFDY 3 IS++ +V AIVNQ++R GE++EDV VVEKILRSL+++FDY Sbjct: 132 ISNFGNKVLAIVNQMKRYGENMEDVRVVEKILRSLIAKFDY 172 Score = 34.3 bits (77), Expect(2) = 7e-10 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = -1 Query: 201 SFGGAKKVRKVHFQTLRGEFESLHI 127 S G KV+KV QTLR EFESLH+ Sbjct: 102 SLEGVDKVKKVRLQTLRREFESLHM 126 >ref|XP_006580654.1| PREDICTED: uncharacterized protein LOC102664387 [Glycine max] Length = 195 Score = 54.7 bits (130), Expect(2) = 7e-10 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = -2 Query: 125 ISDYFPQVQAIVNQLRRNGEDIEDVLVVEKILRSLVSRFDY 3 ISD+ +V AIVNQ++ GE++EDV VVEKILRSL+++FDY Sbjct: 132 ISDFGNKVLAIVNQMKHYGENMEDVRVVEKILRSLIAKFDY 172 Score = 34.3 bits (77), Expect(2) = 7e-10 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = -1 Query: 201 SFGGAKKVRKVHFQTLRGEFESLHI 127 S G KV+KV QTLR EFESLH+ Sbjct: 102 SLEGVDKVKKVRLQTLRREFESLHM 126 >ref|XP_006575849.1| PREDICTED: uncharacterized protein LOC102667917 [Glycine max] Length = 246 Score = 53.1 bits (126), Expect(2) = 2e-09 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = -2 Query: 125 ISDYFPQVQAIVNQLRRNGEDIEDVLVVEKILRSLVSRFDY 3 ISD+ +V AIVNQ++R GE++EDV VV KILRSL+++FDY Sbjct: 122 ISDFGNKVLAIVNQMKRCGENMEDVHVVGKILRSLIAKFDY 162 Score = 34.3 bits (77), Expect(2) = 2e-09 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = -1 Query: 201 SFGGAKKVRKVHFQTLRGEFESLHI 127 S G KV+KV QTLR EFESLH+ Sbjct: 92 SLEGVDKVKKVRLQTLRKEFESLHM 116 >ref|XP_006577639.1| PREDICTED: uncharacterized protein LOC102659578 [Glycine max] Length = 274 Score = 53.9 bits (128), Expect(2) = 3e-09 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = -2 Query: 125 ISDYFPQVQAIVNQLRRNGEDIEDVLVVEKILRSLVSRFDY 3 ISD+ +V AIVNQ++R GE++EDV VVEKI RSL+++FDY Sbjct: 132 ISDFGNKVLAIVNQMKRYGENMEDVHVVEKIRRSLIAKFDY 172 Score = 33.1 bits (74), Expect(2) = 3e-09 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = -1 Query: 201 SFGGAKKVRKVHFQTLRGEFESLHI 127 S G KV+KV QTLR EFESLH+ Sbjct: 102 SLEGVDKVKKVCLQTLRREFESLHM 126 >ref|XP_006601509.1| PREDICTED: uncharacterized protein LOC102663304 [Glycine max] Length = 387 Score = 57.4 bits (137), Expect(2) = 4e-09 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = -2 Query: 125 ISDYFPQVQAIVNQLRRNGEDIEDVLVVEKILRSLVSRFDY 3 ISDYF +V A+VNQL+RNGED+++V V+EKILR+L FD+ Sbjct: 130 ISDYFSRVLAVVNQLKRNGEDVDEVKVMEKILRTLNPSFDF 170 Score = 28.9 bits (63), Expect(2) = 4e-09 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = -1 Query: 192 GAKKVRKVHFQTLRGEFESL 133 G ++V+K+ QTLRG+FE L Sbjct: 103 GVEQVKKIRLQTLRGDFERL 122 >gb|AAG60117.1|AC073555_1 copia-type polyprotein, putative [Arabidopsis thaliana] Length = 1352 Score = 49.7 bits (117), Expect(2) = 2e-08 Identities = 20/41 (48%), Positives = 32/41 (78%) Frame = -2 Query: 125 ISDYFPQVQAIVNQLRRNGEDIEDVLVVEKILRSLVSRFDY 3 +SDYF +V + N L+RNGE ++DV ++EK+LRSL +F++ Sbjct: 131 VSDYFSRVLTVTNNLKRNGEKLDDVRIMEKVLRSLDLKFEH 171 Score = 34.3 bits (77), Expect(2) = 2e-08 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = -1 Query: 201 SFGGAKKVRKVHFQTLRGEFESLHI 127 S+ GA +V+KV QTLRGEFE+L + Sbjct: 101 SYKGADQVKKVRLQTLRGEFEALQM 125 >emb|CAB71063.1| copia-type polyprotein [Arabidopsis thaliana] Length = 1352 Score = 49.7 bits (117), Expect(2) = 2e-08 Identities = 20/41 (48%), Positives = 32/41 (78%) Frame = -2 Query: 125 ISDYFPQVQAIVNQLRRNGEDIEDVLVVEKILRSLVSRFDY 3 +SDYF +V + N L+RNGE ++DV ++EK+LRSL +F++ Sbjct: 131 VSDYFSRVLTVTNNLKRNGEKLDDVRIMEKVLRSLDLKFEH 171 Score = 34.3 bits (77), Expect(2) = 2e-08 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = -1 Query: 201 SFGGAKKVRKVHFQTLRGEFESLHI 127 S+ GA +V+KV QTLRGEFE+L + Sbjct: 101 SYKGADQVKKVRLQTLRGEFEALQM 125 >gb|AAD50001.1|AC007259_14 Hypothetical protein [Arabidopsis thaliana] Length = 1352 Score = 49.7 bits (117), Expect(2) = 2e-08 Identities = 20/41 (48%), Positives = 32/41 (78%) Frame = -2 Query: 125 ISDYFPQVQAIVNQLRRNGEDIEDVLVVEKILRSLVSRFDY 3 +SDYF +V + N L+RNGE ++DV ++EK+LRSL +F++ Sbjct: 131 VSDYFSRVLTVTNNLKRNGEKLDDVRIMEKVLRSLDLKFEH 171 Score = 34.3 bits (77), Expect(2) = 2e-08 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = -1 Query: 201 SFGGAKKVRKVHFQTLRGEFESLHI 127 S+ GA +V+KV QTLRGEFE+L + Sbjct: 101 SYKGADQVKKVRLQTLRGEFEALQM 125 >gb|AAG50698.1|AC079604_5 copia-type polyprotein, putative [Arabidopsis thaliana] gi|12321387|gb|AAG50765.1|AC079131_10 copia-type polyprotein, putative [Arabidopsis thaliana] Length = 1320 Score = 49.7 bits (117), Expect(2) = 2e-08 Identities = 20/41 (48%), Positives = 32/41 (78%) Frame = -2 Query: 125 ISDYFPQVQAIVNQLRRNGEDIEDVLVVEKILRSLVSRFDY 3 +SDYF +V + N L+RNGE ++DV ++EK+LRSL +F++ Sbjct: 131 VSDYFSRVLTVTNNLKRNGEKLDDVRIMEKVLRSLDLKFEH 171 Score = 34.3 bits (77), Expect(2) = 2e-08 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = -1 Query: 201 SFGGAKKVRKVHFQTLRGEFESLHI 127 S+ GA +V+KV QTLRGEFE+L + Sbjct: 101 SYKGADQVKKVRLQTLRGEFEALQM 125 >emb|CAB75469.1| copia-type reverse transcriptase-like protein [Arabidopsis thaliana] Length = 1272 Score = 49.7 bits (117), Expect(2) = 2e-08 Identities = 20/41 (48%), Positives = 32/41 (78%) Frame = -2 Query: 125 ISDYFPQVQAIVNQLRRNGEDIEDVLVVEKILRSLVSRFDY 3 +SDYF +V + N L+RNGE ++DV ++EK+LRSL +F++ Sbjct: 131 VSDYFSRVLTVTNNLKRNGEKLDDVRIMEKVLRSLDLKFEH 171 Score = 34.3 bits (77), Expect(2) = 2e-08 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = -1 Query: 201 SFGGAKKVRKVHFQTLRGEFESLHI 127 S+ GA +V+KV QTLRGEFE+L + Sbjct: 101 SYKGADQVKKVRLQTLRGEFEALQM 125 >emb|CAA69271.1| lectin receptor kinase [Arabidopsis thaliana] Length = 544 Score = 49.7 bits (117), Expect(2) = 2e-08 Identities = 20/41 (48%), Positives = 32/41 (78%) Frame = -2 Query: 125 ISDYFPQVQAIVNQLRRNGEDIEDVLVVEKILRSLVSRFDY 3 +SDYF +V + N L+RNGE ++DV ++EK+LRSL +F++ Sbjct: 147 VSDYFSRVLTVTNNLKRNGEKLDDVRIMEKVLRSLDLKFEH 187 Score = 34.3 bits (77), Expect(2) = 2e-08 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = -1 Query: 201 SFGGAKKVRKVHFQTLRGEFESLHI 127 S+ GA +V+KV QTLRGEFE+L + Sbjct: 117 SYKGADQVKKVRLQTLRGEFEALQM 141 >emb|CAN71055.1| hypothetical protein VITISV_003722 [Vitis vinifera] Length = 136 Score = 60.1 bits (144), Expect(2) = 5e-08 Identities = 27/47 (57%), Positives = 37/47 (78%) Frame = -2 Query: 143 LNHCTYISDYFPQVQAIVNQLRRNGEDIEDVLVVEKILRSLVSRFDY 3 +N +ISDYF +VQ IVNQ+R NGE ++D +V+KI+RSL +RFDY Sbjct: 15 MNDSEFISDYFDRVQTIVNQMRVNGEKLDDQRIVKKIMRSLSARFDY 61 Score = 22.7 bits (47), Expect(2) = 5e-08 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = -1 Query: 162 QTLRGEFESLHI 127 QTLRGEF+SL + Sbjct: 4 QTLRGEFQSLRM 15 >gb|AAF16534.1|AC013482_8 T26F17.17 [Arabidopsis thaliana] Length = 1291 Score = 49.7 bits (117), Expect(2) = 6e-08 Identities = 20/41 (48%), Positives = 32/41 (78%) Frame = -2 Query: 125 ISDYFPQVQAIVNQLRRNGEDIEDVLVVEKILRSLVSRFDY 3 +SDYF +V + N L+RNGE ++DV ++EK+LRSL +F++ Sbjct: 131 VSDYFSRVLTVTNNLKRNGEKLDDVRIMEKVLRSLDLKFEH 171 Score = 32.7 bits (73), Expect(2) = 6e-08 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = -1 Query: 201 SFGGAKKVRKVHFQTLRGEFESLHI 127 S+ G +V+KV QTLRGEFE+L + Sbjct: 101 SYKGVDQVKKVRLQTLRGEFEALQM 125