BLASTX nr result
ID: Paeonia22_contig00038010
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00038010 (414 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004233372.1| PREDICTED: uncharacterized protein LOC101245... 64 2e-08 gb|EPS65082.1| hypothetical protein M569_09700 [Genlisea aurea] 64 2e-08 gb|EYU44136.1| hypothetical protein MIMGU_mgv1a012305mg [Mimulus... 63 4e-08 ref|XP_006363411.1| PREDICTED: uncharacterized protein LOC102602... 62 6e-08 ref|XP_002530009.1| conserved hypothetical protein [Ricinus comm... 59 9e-07 gb|EYU44137.1| hypothetical protein MIMGU_mgv1a012305mg [Mimulus... 57 3e-06 ref|XP_002278703.2| PREDICTED: uncharacterized protein LOC100249... 56 5e-06 >ref|XP_004233372.1| PREDICTED: uncharacterized protein LOC101245722 [Solanum lycopersicum] Length = 241 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -3 Query: 124 KNQTASFD*YL*DKPRVF*AIFLDKRRSHQLNEEEWRIHML 2 +N A FD YL +KPRVF AIF DKRRSHQLN+EEWRIHML Sbjct: 59 ENPRACFDRYLENKPRVFKAIFPDKRRSHQLNQEEWRIHML 99 >gb|EPS65082.1| hypothetical protein M569_09700 [Genlisea aurea] Length = 249 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -3 Query: 112 ASFD*YL*DKPRVF*AIFLDKRRSHQLNEEEWRIHML 2 ASFD YL DKPRVF AIF DKRRS QLNEEEWR+HML Sbjct: 62 ASFDLYLEDKPRVFEAIFPDKRRSQQLNEEEWRVHML 98 >gb|EYU44136.1| hypothetical protein MIMGU_mgv1a012305mg [Mimulus guttatus] Length = 254 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 112 ASFD*YL*DKPRVF*AIFLDKRRSHQLNEEEWRIHML 2 ASFD YL DKPRVF AIF DKRRS+QLNE+EWR+HML Sbjct: 77 ASFDQYLEDKPRVFKAIFPDKRRSNQLNEDEWRVHML 113 >ref|XP_006363411.1| PREDICTED: uncharacterized protein LOC102602574 [Solanum tuberosum] Length = 249 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -3 Query: 112 ASFD*YL*DKPRVF*AIFLDKRRSHQLNEEEWRIHML 2 ASFD YL +KPRVF AIF DKRRS QLNEEEWRIHML Sbjct: 71 ASFDGYLENKPRVFKAIFPDKRRSQQLNEEEWRIHML 107 >ref|XP_002530009.1| conserved hypothetical protein [Ricinus communis] gi|223530488|gb|EEF32371.1| conserved hypothetical protein [Ricinus communis] Length = 237 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -3 Query: 112 ASFD*YL*DKPRVF*AIFLDKRRSHQLNEEEWRIHML 2 ASFD YL DKPRVF A+F DKRRS QLN+EEWRI ML Sbjct: 81 ASFDRYLEDKPRVFKAMFPDKRRSEQLNKEEWRIQML 117 >gb|EYU44137.1| hypothetical protein MIMGU_mgv1a012305mg [Mimulus guttatus] Length = 249 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 97 YL*DKPRVF*AIFLDKRRSHQLNEEEWRIHML 2 YL DKPRVF AIF DKRRS+QLNE+EWR+HML Sbjct: 77 YLEDKPRVFKAIFPDKRRSNQLNEDEWRVHML 108 >ref|XP_002278703.2| PREDICTED: uncharacterized protein LOC100249192 [Vitis vinifera] gi|296082953|emb|CBI22254.3| unnamed protein product [Vitis vinifera] Length = 251 Score = 56.2 bits (134), Expect = 5e-06 Identities = 42/93 (45%), Positives = 47/93 (50%), Gaps = 22/93 (23%) Frame = -3 Query: 214 LSKGLWKRQL-KHIQPW*TNAVN*TKRQISIKNQT---------------------ASFD 101 L G WK QL K + W + V K Q IKNQ A FD Sbjct: 20 LGIGKWKDQLVKPNRQW--HVVTQPKWQPVIKNQMVKPSTYTSRISTDLPLYESPGALFD 77 Query: 100 *YL*DKPRVF*AIFLDKRRSHQLNEEEWRIHML 2 YL D+PRVF AIF DKRRS ++NEEEWRI ML Sbjct: 78 EYLEDQPRVFKAIFPDKRRSQRINEEEWRIQML 110