BLASTX nr result
ID: Paeonia22_contig00037855
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00037855 (417 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007011735.1| Nucleic acid binding protein, putative isofo... 59 5e-07 ref|XP_007011733.1| Nucleic acid binding protein, putative isofo... 59 5e-07 >ref|XP_007011735.1| Nucleic acid binding protein, putative isoform 3, partial [Theobroma cacao] gi|590571959|ref|XP_007011736.1| Nucleic acid binding protein, putative isoform 3, partial [Theobroma cacao] gi|508782098|gb|EOY29354.1| Nucleic acid binding protein, putative isoform 3, partial [Theobroma cacao] gi|508782099|gb|EOY29355.1| Nucleic acid binding protein, putative isoform 3, partial [Theobroma cacao] Length = 654 Score = 59.3 bits (142), Expect = 5e-07 Identities = 34/60 (56%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Frame = +1 Query: 1 VLYDDGDVEILNLKTQRWELIRDELLPDEGKQADHLPSHDASSEM-WKKEEKVESVPSFK 177 VLY+DGD EILNLK ++WE I DE DE + ADH PS D SSEM KK+ K P+ K Sbjct: 410 VLYNDGDQEILNLKREKWEFIEDESGSDEEEAADH-PSPDGSSEMPQKKKAKSSDQPTKK 468 >ref|XP_007011733.1| Nucleic acid binding protein, putative isoform 1 [Theobroma cacao] gi|590571951|ref|XP_007011734.1| Nucleic acid binding protein, putative isoform 1 [Theobroma cacao] gi|508782096|gb|EOY29352.1| Nucleic acid binding protein, putative isoform 1 [Theobroma cacao] gi|508782097|gb|EOY29353.1| Nucleic acid binding protein, putative isoform 1 [Theobroma cacao] Length = 927 Score = 59.3 bits (142), Expect = 5e-07 Identities = 34/60 (56%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Frame = +1 Query: 1 VLYDDGDVEILNLKTQRWELIRDELLPDEGKQADHLPSHDASSEM-WKKEEKVESVPSFK 177 VLY+DGD EILNLK ++WE I DE DE + ADH PS D SSEM KK+ K P+ K Sbjct: 671 VLYNDGDQEILNLKREKWEFIEDESGSDEEEAADH-PSPDGSSEMPQKKKAKSSDQPTKK 729