BLASTX nr result
ID: Paeonia22_contig00037731
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00037731 (238 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXJ71966.1| hypothetical protein A1O5_04468 [Cladophialophora... 59 7e-07 >gb|EXJ71966.1| hypothetical protein A1O5_04468 [Cladophialophora psammophila CBS 110553] Length = 87 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -2 Query: 93 MVAIKKYIPNFLLPTEEPQTPGRIYDVPLRR 1 M A+KKY+P+FLLPT+EPQ PGRIYDVPLRR Sbjct: 1 MSALKKYVPSFLLPTDEPQQPGRIYDVPLRR 31