BLASTX nr result
ID: Paeonia22_contig00037695
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00037695 (319 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004302285.1| PREDICTED: uncharacterized protein LOC101303... 57 2e-06 gb|ACJ83877.1| unknown [Medicago truncatula] gi|388521237|gb|AFK... 55 8e-06 >ref|XP_004302285.1| PREDICTED: uncharacterized protein LOC101303238 [Fragaria vesca subsp. vesca] Length = 161 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/40 (57%), Positives = 33/40 (82%) Frame = +3 Query: 3 KELMLWVNICDIYRGSPASDKLCFKAPTRVFRSFPLSAFQ 122 KELM+WV+ICDI+ P + K+ FK+PT +FR+FP+SAF+ Sbjct: 100 KELMIWVSICDIFLDDPPTGKITFKSPTGLFRTFPVSAFE 139 >gb|ACJ83877.1| unknown [Medicago truncatula] gi|388521237|gb|AFK48680.1| unknown [Medicago truncatula] Length = 170 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/40 (55%), Positives = 31/40 (77%) Frame = +3 Query: 3 KELMLWVNICDIYRGSPASDKLCFKAPTRVFRSFPLSAFQ 122 KEL++WV +CDIY P + K+ FK P+ +FRSFP+SAF+ Sbjct: 99 KELLIWVTLCDIYIDDPPTGKITFKTPSGLFRSFPVSAFE 138