BLASTX nr result
ID: Paeonia22_contig00037662
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00037662 (327 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007203331.1| hypothetical protein PRUPE_ppa020156mg [Prun... 60 3e-07 >ref|XP_007203331.1| hypothetical protein PRUPE_ppa020156mg [Prunus persica] gi|462398862|gb|EMJ04530.1| hypothetical protein PRUPE_ppa020156mg [Prunus persica] Length = 347 Score = 60.1 bits (144), Expect = 3e-07 Identities = 37/108 (34%), Positives = 56/108 (51%), Gaps = 6/108 (5%) Frame = -2 Query: 326 VAKRLDGDTDY--LRSICNSWRSYILPINNKSFTQFSINFIQKSDFPRGSELKCCDDYTI 153 V KRL TD R+IC SWRS +LP + K +F I + K FP C TI Sbjct: 19 VGKRLKTKTDVSRFRAICRSWRSSVLPFDQKQ-PRFPIRIMMKFPFPVN-----CFFLTI 72 Query: 152 VESRIYHLQP----RNSSSSSDNDLKGWLVKIEEQKGSQKLQLMHPVT 21 E +YHL P + S+S + +GW+V++ E + + ++HP++ Sbjct: 73 TEDTVYHLVPPPNINSDDSASTSSTRGWVVRLREGESGEP-SMLHPLS 119