BLASTX nr result
ID: Paeonia22_contig00037566
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00037566 (246 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007203318.1| hypothetical protein PRUPE_ppa019964mg, part... 46 4e-06 ref|XP_007219137.1| hypothetical protein PRUPE_ppa015965mg [Prun... 46 4e-06 ref|XP_007224256.1| hypothetical protein PRUPE_ppa018408mg, part... 46 4e-06 ref|XP_007226950.1| hypothetical protein PRUPE_ppa025194mg, part... 46 4e-06 ref|XP_007220363.1| hypothetical protein PRUPE_ppa016496mg, part... 45 6e-06 >ref|XP_007203318.1| hypothetical protein PRUPE_ppa019964mg, partial [Prunus persica] gi|462398849|gb|EMJ04517.1| hypothetical protein PRUPE_ppa019964mg, partial [Prunus persica] Length = 1488 Score = 45.8 bits (107), Expect(2) = 4e-06 Identities = 19/27 (70%), Positives = 23/27 (85%) Frame = +1 Query: 49 RYSKTQKIKFASLKLSDHAPSWWKSHK 129 +YS QKIKFASLKLS HA +WWKS++ Sbjct: 146 KYSNVQKIKFASLKLSSHALTWWKSYQ 172 Score = 30.4 bits (67), Expect(2) = 4e-06 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +3 Query: 129 KHHRIECLT*KEF*RHFCKQFYLVRYEEETLYKRQQF 239 + + + LT K F + KQFY V YE+E YK Q F Sbjct: 173 RRYDVSELTWKNFKKLLRKQFYPVGYEDERWYKWQHF 209 >ref|XP_007219137.1| hypothetical protein PRUPE_ppa015965mg [Prunus persica] gi|462415599|gb|EMJ20336.1| hypothetical protein PRUPE_ppa015965mg [Prunus persica] Length = 1484 Score = 45.8 bits (107), Expect(2) = 4e-06 Identities = 19/27 (70%), Positives = 23/27 (85%) Frame = +1 Query: 49 RYSKTQKIKFASLKLSDHAPSWWKSHK 129 +YS QKIKFASLKLS HA +WWKS++ Sbjct: 156 KYSNVQKIKFASLKLSSHALTWWKSYQ 182 Score = 30.4 bits (67), Expect(2) = 4e-06 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +3 Query: 129 KHHRIECLT*KEF*RHFCKQFYLVRYEEETLYKRQQF 239 + + + LT K F + KQFY V YE+E YK Q F Sbjct: 183 RRYDVSELTWKNFKKLLRKQFYPVGYEDERWYKWQHF 219 >ref|XP_007224256.1| hypothetical protein PRUPE_ppa018408mg, partial [Prunus persica] gi|462421192|gb|EMJ25455.1| hypothetical protein PRUPE_ppa018408mg, partial [Prunus persica] Length = 1440 Score = 45.8 bits (107), Expect(2) = 4e-06 Identities = 19/27 (70%), Positives = 23/27 (85%) Frame = +1 Query: 49 RYSKTQKIKFASLKLSDHAPSWWKSHK 129 +YS QKIKFASLKLS HA +WWKS++ Sbjct: 146 KYSNVQKIKFASLKLSSHALTWWKSYQ 172 Score = 30.4 bits (67), Expect(2) = 4e-06 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +3 Query: 129 KHHRIECLT*KEF*RHFCKQFYLVRYEEETLYKRQQF 239 + + + LT K F + KQFY V YE+E YK Q F Sbjct: 173 RRYDVSELTWKNFKKLLRKQFYPVGYEDERWYKWQHF 209 >ref|XP_007226950.1| hypothetical protein PRUPE_ppa025194mg, partial [Prunus persica] gi|462423886|gb|EMJ28149.1| hypothetical protein PRUPE_ppa025194mg, partial [Prunus persica] Length = 1347 Score = 45.8 bits (107), Expect(2) = 4e-06 Identities = 19/27 (70%), Positives = 23/27 (85%) Frame = +1 Query: 49 RYSKTQKIKFASLKLSDHAPSWWKSHK 129 +YS QKIKFASLKLS HA +WWKS++ Sbjct: 75 KYSNVQKIKFASLKLSSHALTWWKSYQ 101 Score = 30.4 bits (67), Expect(2) = 4e-06 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +3 Query: 129 KHHRIECLT*KEF*RHFCKQFYLVRYEEETLYKRQQF 239 + + + LT K F + KQFY V YE+E YK Q F Sbjct: 102 RRYDVSELTWKNFKKLLRKQFYPVGYEDERWYKWQHF 138 >ref|XP_007220363.1| hypothetical protein PRUPE_ppa016496mg, partial [Prunus persica] gi|462416825|gb|EMJ21562.1| hypothetical protein PRUPE_ppa016496mg, partial [Prunus persica] Length = 373 Score = 45.1 bits (105), Expect(2) = 6e-06 Identities = 18/27 (66%), Positives = 23/27 (85%) Frame = +1 Query: 49 RYSKTQKIKFASLKLSDHAPSWWKSHK 129 +YS QKIKFAS+KLS HA +WWKS++ Sbjct: 34 KYSNVQKIKFASMKLSSHALTWWKSYQ 60 Score = 30.4 bits (67), Expect(2) = 6e-06 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +3 Query: 129 KHHRIECLT*KEF*RHFCKQFYLVRYEEETLYKRQQF 239 + + + LT K F + KQFY V YE+E YK Q F Sbjct: 61 RRYDVSELTWKNFKKLLRKQFYPVGYEDERWYKWQHF 97