BLASTX nr result
ID: Paeonia22_contig00037550
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00037550 (276 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXJ63491.1| ATP-citrate synthase subunit 1 [Cladophialophora ... 69 5e-10 gb|ETI21547.1| ATP-citrate synthase subunit 1 [Cladophialophora ... 67 2e-09 gb|EXJ55987.1| ATP-citrate synthase subunit 1 [Cladophialophora ... 65 7e-09 gb|ERF71936.1| ATP-citrate synthase subunit 1 [Endocarpon pusill... 58 1e-06 gb|EKG19227.1| Citrate synthase-like protein [Macrophomina phase... 58 2e-06 gb|EXJ84402.1| ATP-citrate synthase subunit 1 [Capronia epimyces... 57 2e-06 ref|XP_007581568.1| putative atp-citrate synthase subunit 1 prot... 57 3e-06 gb|EMF09503.1| ATP-citrate synthase (ATP-citrate (pro-S-)-lyase)... 57 3e-06 gb|EME78439.1| hypothetical protein MYCFIDRAFT_212387 [Pseudocer... 57 3e-06 gb|ELQ69238.1| ATP-citrate synthase subunit 1 [Magnaporthe oryza... 55 8e-06 gb|ELQ38533.1| ATP-citrate synthase subunit 1 [Magnaporthe oryza... 55 8e-06 ref|XP_003709430.1| ATP-citrate synthase subunit 1 [Magnaporthe ... 55 8e-06 >gb|EXJ63491.1| ATP-citrate synthase subunit 1 [Cladophialophora psammophila CBS 110553] Length = 674 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 YRHPWDDITYLLPTLGKTPGNEGRVEVSTQ 90 YRHPWDDITYLLPTLGKTPGNEGRVEVSTQ Sbjct: 645 YRHPWDDITYLLPTLGKTPGNEGRVEVSTQ 674 >gb|ETI21547.1| ATP-citrate synthase subunit 1 [Cladophialophora carrionii CBS 160.54] Length = 674 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 YRHPWDDITYLLPTLGKTPGNEGRVEVST 87 YRHPWDDITYLLPTLGKTPGNEGRVEVST Sbjct: 645 YRHPWDDITYLLPTLGKTPGNEGRVEVST 673 >gb|EXJ55987.1| ATP-citrate synthase subunit 1 [Cladophialophora yegresii CBS 114405] Length = 673 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +1 Query: 1 YRHPWDDITYLLPTLGKTPGNEGRVEVSTQ 90 YRHPWDDITYLLPTLGKTPGNEGRVEV Q Sbjct: 644 YRHPWDDITYLLPTLGKTPGNEGRVEVDPQ 673 >gb|ERF71936.1| ATP-citrate synthase subunit 1 [Endocarpon pusillum Z07020] Length = 680 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 1/29 (3%) Frame = +1 Query: 1 YRHPWDDITYLLPTLGK-TPGNEGRVEVS 84 YRHPWDDITYLLPTLGK PGNEGRVEVS Sbjct: 651 YRHPWDDITYLLPTLGKGGPGNEGRVEVS 679 >gb|EKG19227.1| Citrate synthase-like protein [Macrophomina phaseolina MS6] Length = 658 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/29 (89%), Positives = 27/29 (93%), Gaps = 1/29 (3%) Frame = +1 Query: 1 YRHPWDDITYLLPTLGK-TPGNEGRVEVS 84 YRHPWDDITYLLPT+GK PGNEGRVEVS Sbjct: 629 YRHPWDDITYLLPTVGKGAPGNEGRVEVS 657 >gb|EXJ84402.1| ATP-citrate synthase subunit 1 [Capronia epimyces CBS 606.96] Length = 676 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 1 YRHPWDDITYLLPTLGKTPGNEGRVEVS 84 YRHPWDDITYLLPTL K GNEGRVEVS Sbjct: 648 YRHPWDDITYLLPTLAKGSGNEGRVEVS 675 >ref|XP_007581568.1| putative atp-citrate synthase subunit 1 protein [Neofusicoccum parvum UCRNP2] gi|485926724|gb|EOD50943.1| putative atp-citrate synthase subunit 1 protein [Neofusicoccum parvum UCRNP2] Length = 659 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/29 (89%), Positives = 26/29 (89%), Gaps = 1/29 (3%) Frame = +1 Query: 1 YRHPWDDITYLLPTLGK-TPGNEGRVEVS 84 YRHPWDDITYLLPT GK PGNEGRVEVS Sbjct: 630 YRHPWDDITYLLPTAGKGAPGNEGRVEVS 658 >gb|EMF09503.1| ATP-citrate synthase (ATP-citrate (pro-S-)-lyase) [Sphaerulina musiva SO2202] Length = 665 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/29 (89%), Positives = 26/29 (89%), Gaps = 1/29 (3%) Frame = +1 Query: 1 YRHPWDDITYLLPTLGK-TPGNEGRVEVS 84 YRHPWDDITYLLP LGK PGNEGRVEVS Sbjct: 636 YRHPWDDITYLLPELGKGAPGNEGRVEVS 664 >gb|EME78439.1| hypothetical protein MYCFIDRAFT_212387 [Pseudocercospora fijiensis CIRAD86] Length = 666 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/29 (89%), Positives = 26/29 (89%), Gaps = 1/29 (3%) Frame = +1 Query: 1 YRHPWDDITYLLPTLGK-TPGNEGRVEVS 84 YRHPWDDITYLLP LGK PGNEGRVEVS Sbjct: 636 YRHPWDDITYLLPELGKGAPGNEGRVEVS 664 >gb|ELQ69238.1| ATP-citrate synthase subunit 1 [Magnaporthe oryzae P131] Length = 665 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/28 (89%), Positives = 26/28 (92%), Gaps = 1/28 (3%) Frame = +1 Query: 1 YRHPWDDITYLLPTLGKT-PGNEGRVEV 81 YRHPWDDITYLLPTL +T PGNEGRVEV Sbjct: 636 YRHPWDDITYLLPTLSQTQPGNEGRVEV 663 >gb|ELQ38533.1| ATP-citrate synthase subunit 1 [Magnaporthe oryzae Y34] Length = 665 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/28 (89%), Positives = 26/28 (92%), Gaps = 1/28 (3%) Frame = +1 Query: 1 YRHPWDDITYLLPTLGKT-PGNEGRVEV 81 YRHPWDDITYLLPTL +T PGNEGRVEV Sbjct: 636 YRHPWDDITYLLPTLSQTQPGNEGRVEV 663 >ref|XP_003709430.1| ATP-citrate synthase subunit 1 [Magnaporthe oryzae 70-15] gi|351648959|gb|EHA56818.1| ATP-citrate synthase subunit 1 [Magnaporthe oryzae 70-15] Length = 665 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/28 (89%), Positives = 26/28 (92%), Gaps = 1/28 (3%) Frame = +1 Query: 1 YRHPWDDITYLLPTLGKT-PGNEGRVEV 81 YRHPWDDITYLLPTL +T PGNEGRVEV Sbjct: 636 YRHPWDDITYLLPTLSQTQPGNEGRVEV 663