BLASTX nr result
ID: Paeonia22_contig00037501
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00037501 (301 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007032641.1| Pentatricopeptide repeat-containing protein,... 56 5e-06 >ref|XP_007032641.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] gi|508711670|gb|EOY03567.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 790 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -1 Query: 286 LVSNFYAESGKWDEVARIRAMAKARGLEKTPGHSFI 179 LVSN YAESGKWD AR+R MAK RGL+K PG+S I Sbjct: 749 LVSNLYAESGKWDAAARMRNMAKKRGLKKPPGYSLI 784