BLASTX nr result
ID: Paeonia22_contig00037346
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00037346 (319 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_019157272.1| hydrolase [Bacillus massiliosenegalensis] 92 7e-17 ref|WP_005727912.1| cell wall-associated hydrolase, partial [Lac... 92 7e-17 emb|CBL49511.1| Cell wall-associated hydrolase [Lactobacillus cr... 92 7e-17 ref|WP_000947360.1| hypothetical protein [Bacillus anthracis] 89 5e-16 ref|WP_019846892.1| hypothetical protein, partial [Bacillus subt... 87 2e-15 ref|WP_007496004.1| cell wall-associated hydrolase [Bacillus str... 87 2e-15 ref|WP_009329011.1| hydrolase [Bacillus sp. BT1B_CT2] gi|3173914... 87 2e-15 ref|YP_006991812.2| cell wall-associated hydrolase [Carnobacteri... 87 2e-15 ref|YP_006991288.1| cell wall-associated hydrolase family protei... 87 2e-15 ref|WP_003726098.1| hydrolase [Listeria monocytogenes] gi|470171... 86 5e-15 ref|YP_006994087.2| cell wall-associated hydrolase family protei... 86 5e-15 ref|WP_009063254.1| conserved hypothetical protein, partial [Str... 86 5e-15 gb|EOS53058.1| hypothetical protein C809_00001 [Lachnospiraceae ... 57 5e-15 ref|WP_006574686.1| hypothetical protein [Pseudoflavonifractor c... 72 6e-15 ref|WP_003355051.1| hypothetical protein, partial [Bacillus smit... 86 7e-15 ref|WP_009331575.1| hypothetical protein, partial [Bacillus sp. ... 86 7e-15 ref|WP_009333424.1| hypothetical protein, partial [Bacillus sp. ... 86 7e-15 ref|WP_009336407.1| hypothetical protein, partial [Bacillus sp. ... 86 7e-15 ref|WP_009336734.1| hypothetical protein, partial [Bacillus sp. ... 86 7e-15 ref|WP_005425554.1| hypothetical protein [[Ruminococcus] obeum] ... 86 7e-15 >ref|WP_019157272.1| hydrolase [Bacillus massiliosenegalensis] Length = 105 Score = 92.0 bits (227), Expect = 7e-17 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -1 Query: 133 MLSALIPSAHSYPAVLLAEQLVHQRCVHPGPLVLRTAPLKFPTP 2 MLSALIPSAHSYPA+LLAEQLVHQRCVHPGPLVLRTAPLKFPTP Sbjct: 1 MLSALIPSAHSYPAMLLAEQLVHQRCVHPGPLVLRTAPLKFPTP 44 >ref|WP_005727912.1| cell wall-associated hydrolase, partial [Lactobacillus crispatus] gi|310895165|gb|EFQ44233.1| hypothetical protein LBKG_01250, partial [Lactobacillus crispatus CTV-05] Length = 49 Score = 92.0 bits (227), Expect = 7e-17 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -1 Query: 133 MLSALIPSAHSYPAVLLAEQLVHQRCVHPGPLVLRTAPLKFPTP 2 MLSALIPSAHSYPA+LLAEQLVHQRCVHPGPLVLRTAPLKFPTP Sbjct: 1 MLSALIPSAHSYPAMLLAEQLVHQRCVHPGPLVLRTAPLKFPTP 44 >emb|CBL49511.1| Cell wall-associated hydrolase [Lactobacillus crispatus ST1] gi|295031617|emb|CBL51096.1| Cell wall-associated hydrolase [Lactobacillus crispatus ST1] Length = 105 Score = 92.0 bits (227), Expect = 7e-17 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -1 Query: 133 MLSALIPSAHSYPAVLLAEQLVHQRCVHPGPLVLRTAPLKFPTP 2 MLSALIPSAHSYPA+LLAEQLVHQRCVHPGPLVLRTAPLKFPTP Sbjct: 1 MLSALIPSAHSYPAMLLAEQLVHQRCVHPGPLVLRTAPLKFPTP 44 >ref|WP_000947360.1| hypothetical protein [Bacillus anthracis] Length = 105 Score = 89.4 bits (220), Expect = 5e-16 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -1 Query: 133 MLSALIPSAHSYPAVLLAEQLVHQRCVHPGPLVLRTAPLKFPTP 2 MLSALIPSAHSYPA+ LAEQLVHQRCVHPGPLVLRTAPLKFPTP Sbjct: 1 MLSALIPSAHSYPAMPLAEQLVHQRCVHPGPLVLRTAPLKFPTP 44 >ref|WP_019846892.1| hypothetical protein, partial [Bacillus subtilis] Length = 48 Score = 87.4 bits (215), Expect = 2e-15 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = -1 Query: 133 MLSALIPSAHSYPAVLLAEQLVHQRCVHPGPLVLRTAPLKFPTP 2 MLSALIPSAHSYPA+ LAEQLVHQRCVHPGPLVLRTAPLKFP P Sbjct: 1 MLSALIPSAHSYPAMPLAEQLVHQRCVHPGPLVLRTAPLKFPAP 44 >ref|WP_007496004.1| cell wall-associated hydrolase [Bacillus stratosphericus] gi|460150955|gb|EMI15244.1| cell wall-associated hydrolase [Bacillus stratosphericus LAMA 585] Length = 105 Score = 87.4 bits (215), Expect = 2e-15 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = -1 Query: 133 MLSALIPSAHSYPAVLLAEQLVHQRCVHPGPLVLRTAPLKFPTP 2 MLSALIPSAHSYPA+ LAEQLVHQRCVHPGPLVLRTAPLKFP P Sbjct: 1 MLSALIPSAHSYPAMPLAEQLVHQRCVHPGPLVLRTAPLKFPAP 44 >ref|WP_009329011.1| hydrolase [Bacillus sp. BT1B_CT2] gi|317391466|gb|EFV72264.1| hypothetical protein HMPREF1012_02144 [Bacillus sp. BT1B_CT2] Length = 105 Score = 87.4 bits (215), Expect = 2e-15 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = -1 Query: 133 MLSALIPSAHSYPAVLLAEQLVHQRCVHPGPLVLRTAPLKFPTP 2 MLSALIPSAHSYPA+ LAEQLVHQRCVHPGPLVLRTAPLKFP P Sbjct: 1 MLSALIPSAHSYPAMPLAEQLVHQRCVHPGPLVLRTAPLKFPAP 44 >ref|YP_006991812.2| cell wall-associated hydrolase [Carnobacterium maltaromaticum LMA28] gi|511300989|ref|WP_016356361.1| cell wall-associated hydrolase [Carnobacterium maltaromaticum] gi|508079557|emb|CCO10497.2| cell wall-associated hydrolase [Carnobacterium maltaromaticum LMA28] Length = 64 Score = 87.0 bits (214), Expect = 2e-15 Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = -1 Query: 133 MLSALIPSAHSYPAVLLAEQLVHQRCVHPGPLVLRTAPLKFPTP 2 MLSA IPS HSYPA+LLAEQLVHQRCVHPGPLVLRTAPLKFP P Sbjct: 1 MLSAFIPSTHSYPAMLLAEQLVHQRCVHPGPLVLRTAPLKFPAP 44 >ref|YP_006991288.1| cell wall-associated hydrolase family protein [Carnobacterium maltaromaticum LMA28] gi|508605729|ref|YP_006991394.2| cell wall-associated hydrolase family protein [Carnobacterium maltaromaticum LMA28] gi|508607368|ref|YP_006991405.1| cell wall-associated hydrolase family protein [Carnobacterium maltaromaticum LMA28] gi|511300719|ref|WP_016356314.1| cell wall-associated hydrolase family protein [Carnobacterium maltaromaticum] gi|412996164|emb|CCO09973.1| cell wall-associated hydrolase family protein [Carnobacterium maltaromaticum LMA28] gi|412996281|emb|CCO10090.1| cell wall-associated hydrolase family protein [Carnobacterium maltaromaticum LMA28] gi|508079215|emb|CCO10079.2| cell wall-associated hydrolase family protein [Carnobacterium maltaromaticum LMA28] Length = 105 Score = 87.0 bits (214), Expect = 2e-15 Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = -1 Query: 133 MLSALIPSAHSYPAVLLAEQLVHQRCVHPGPLVLRTAPLKFPTP 2 MLSA IPS HSYPA+LLAEQLVHQRCVHPGPLVLRTAPLKFP P Sbjct: 1 MLSAFIPSTHSYPAMLLAEQLVHQRCVHPGPLVLRTAPLKFPAP 44 >ref|WP_003726098.1| hydrolase [Listeria monocytogenes] gi|47017114|gb|EAL07977.1| conserved hypothetical protein [Listeria monocytogenes str. 4b H7858] gi|47017190|gb|EAL08039.1| conserved hypothetical protein [Listeria monocytogenes str. 4b H7858] gi|47017934|gb|EAL08714.1| conserved hypothetical protein [Listeria monocytogenes str. 4b H7858] gi|47018076|gb|EAL08849.1| conserved hypothetical protein [Listeria monocytogenes serotype 4b str. H7858] Length = 105 Score = 85.9 bits (211), Expect = 5e-15 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -1 Query: 133 MLSALIPSAHSYPAVLLAEQLVHQRCVHPGPLVLRTAPLKFPTP 2 MLSA IP+ HSYPA+LLAEQLVHQRCVHPGPLVLRTAPLKFP P Sbjct: 1 MLSAFIPATHSYPAMLLAEQLVHQRCVHPGPLVLRTAPLKFPAP 44 >ref|YP_006994087.2| cell wall-associated hydrolase family protein [Carnobacterium maltaromaticum LMA28] gi|511302315|ref|WP_016356670.1| cell wall-associated hydrolase family protein [Carnobacterium maltaromaticum] gi|508081587|emb|CCO12772.2| cell wall-associated hydrolase family protein [Carnobacterium maltaromaticum LMA28] Length = 110 Score = 85.9 bits (211), Expect = 5e-15 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -1 Query: 133 MLSALIPSAHSYPAVLLAEQLVHQRCVHPGPLVLRTAPLKFPTP 2 MLSA IPS HSYPA+LLAEQLVHQRCVHPGPLVL+TAPLKFP P Sbjct: 1 MLSAFIPSTHSYPAMLLAEQLVHQRCVHPGPLVLKTAPLKFPAP 44 >ref|WP_009063254.1| conserved hypothetical protein, partial [Streptomyces sp. SPB78] gi|302426768|gb|EFK98583.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sp. SPB78] gi|302429649|gb|EFL01465.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sp. SPB78] gi|302429953|gb|EFL01769.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sp. SPB78] Length = 74 Score = 85.9 bits (211), Expect = 5e-15 Identities = 40/74 (54%), Positives = 49/74 (66%) Frame = -2 Query: 255 YPSAARVATLPPRTYLPCHLQGILLA*RDGKSHLEGGFTLRCFQRLSLPHIATQLCSWRN 76 Y S + LP Y P L G L + G +HLE GF LRCFQRLSLP++A Q C W+N Sbjct: 1 YRSTPPLTGLPYPAYQPSRLLGALPSQGGGNTHLEAGFPLRCFQRLSLPNVANQPCPWQN 60 Query: 75 NWYTSGASIPVLSY 34 NW+T G+S+PVLSY Sbjct: 61 NWHTRGSSVPVLSY 74 >gb|EOS53058.1| hypothetical protein C809_00001 [Lachnospiraceae bacterium COE1] Length = 182 Score = 57.0 bits (136), Expect(2) = 5e-15 Identities = 36/66 (54%), Positives = 40/66 (60%) Frame = -3 Query: 293 PIASSELSPRSISIRQLHVSPRFHLGPIYLVIFKGSYSLDAMGNLILRGASRLDAFSAYP 114 P +S R IS QL+ H PIYLV+FKGSY L + G LI ASRLDAFS YP Sbjct: 26 PTMLVRISFRPISGIQLNTLLHLHPCPIYLVVFKGSYRLRS-GQLISGEASRLDAFSVYP 84 Query: 113 FRT*LP 96 RT LP Sbjct: 85 CRTWLP 90 Score = 49.3 bits (116), Expect(2) = 5e-15 Identities = 21/28 (75%), Positives = 23/28 (82%) Frame = -1 Query: 85 LAEQLVHQRCVHPGPLVLRTAPLKFPTP 2 + Q VHQR VHPGPLVLRTAPL +PTP Sbjct: 94 VGRQQVHQRSVHPGPLVLRTAPLSYPTP 121 >ref|WP_006574686.1| hypothetical protein [Pseudoflavonifractor capillosus] gi|150270400|gb|EDM97723.1| hypothetical protein BACCAP_04464 [Pseudoflavonifractor capillosus ATCC 29799] gi|150270680|gb|EDM97982.1| hypothetical protein BACCAP_04210 [Pseudoflavonifractor capillosus ATCC 29799] Length = 83 Score = 72.0 bits (175), Expect(2) = 6e-15 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -2 Query: 165 KSHLEGGFTLRCFQRLSLPHIATQLCSWRNNWYTSGASIPVLSY 34 + HL G FTLRC QRLS P+IATQLC W++NW T G SIPVLSY Sbjct: 40 RPHLRGSFTLRCLQRLSRPYIATQLCPWQDNWCTRGTSIPVLSY 83 Score = 34.3 bits (77), Expect(2) = 6e-15 Identities = 17/30 (56%), Positives = 19/30 (63%) Frame = -3 Query: 272 SPRSISIRQLHVSPRFHLGPIYLVIFKGSY 183 SPR IS QLHV P FHL PI V++ Y Sbjct: 5 SPRLISTGQLHVLPHFHLRPINDVVYIEPY 34 >ref|WP_003355051.1| hypothetical protein, partial [Bacillus smithii] gi|363623531|gb|EHL74644.1| hypothetical protein HMPREF1015_03282, partial [Bacillus smithii 7_3_47FAA] Length = 92 Score = 85.5 bits (210), Expect = 7e-15 Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = -1 Query: 133 MLSALIPSAHSYPAVLLAEQLVHQRCVHPGPLVLRTAPLKFPTP 2 MLSALIPSAHSYPA+ LA QLVHQRCVHPGPLVLRTAPLKFP P Sbjct: 1 MLSALIPSAHSYPAMPLARQLVHQRCVHPGPLVLRTAPLKFPAP 44 >ref|WP_009331575.1| hypothetical protein, partial [Bacillus sp. 2_A_57_CT2] gi|317398039|gb|EFV78732.1| hypothetical protein HMPREF1013_01038 [Bacillus sp. 2_A_57_CT2] Length = 104 Score = 85.5 bits (210), Expect = 7e-15 Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = -1 Query: 133 MLSALIPSAHSYPAVLLAEQLVHQRCVHPGPLVLRTAPLKFPTP 2 MLSALIPSAHSYPA+ LA QLVHQRCVHPGPLVLRTAPLKFP P Sbjct: 1 MLSALIPSAHSYPAMPLARQLVHQRCVHPGPLVLRTAPLKFPAP 44 >ref|WP_009333424.1| hypothetical protein, partial [Bacillus sp. 2_A_57_CT2] gi|317396376|gb|EFV77092.1| hypothetical protein HMPREF1013_02711 [Bacillus sp. 2_A_57_CT2] Length = 69 Score = 85.5 bits (210), Expect = 7e-15 Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = -1 Query: 133 MLSALIPSAHSYPAVLLAEQLVHQRCVHPGPLVLRTAPLKFPTP 2 MLSALIPSAHSYPA+ LA QLVHQRCVHPGPLVLRTAPLKFP P Sbjct: 1 MLSALIPSAHSYPAMPLARQLVHQRCVHPGPLVLRTAPLKFPAP 44 >ref|WP_009336407.1| hypothetical protein, partial [Bacillus sp. 2_A_57_CT2] gi|317393578|gb|EFV74338.1| hypothetical protein HMPREF1013_05453 [Bacillus sp. 2_A_57_CT2] Length = 84 Score = 85.5 bits (210), Expect = 7e-15 Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = -1 Query: 133 MLSALIPSAHSYPAVLLAEQLVHQRCVHPGPLVLRTAPLKFPTP 2 MLSALIPSAHSYPA+ LA QLVHQRCVHPGPLVLRTAPLKFP P Sbjct: 1 MLSALIPSAHSYPAMPLARQLVHQRCVHPGPLVLRTAPLKFPAP 44 >ref|WP_009336734.1| hypothetical protein, partial [Bacillus sp. 2_A_57_CT2] gi|317393278|gb|EFV74045.1| hypothetical protein HMPREF1013_05704 [Bacillus sp. 2_A_57_CT2] Length = 69 Score = 85.5 bits (210), Expect = 7e-15 Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = -1 Query: 133 MLSALIPSAHSYPAVLLAEQLVHQRCVHPGPLVLRTAPLKFPTP 2 MLSALIPSAHSYPA+ LA QLVHQRCVHPGPLVLRTAPLKFP P Sbjct: 1 MLSALIPSAHSYPAMPLARQLVHQRCVHPGPLVLRTAPLKFPAP 44 >ref|WP_005425554.1| hypothetical protein [[Ruminococcus] obeum] gi|149830229|gb|EDM85322.1| hypothetical protein RUMOBE_04123 [Ruminococcus obeum ATCC 29174] Length = 97 Score = 85.5 bits (210), Expect = 7e-15 Identities = 47/71 (66%), Positives = 48/71 (67%) Frame = -3 Query: 272 SPRSISIRQLHVSPRFHLGPIYLVIFKGSYSLDAMGNLILRGASRLDAFSAYPFRT*LPS 93 SP IS QLHV P FHL PI LV+FKG YS MG LILRGASRLDAFS YPFR LP Sbjct: 6 SPHPISSSQLHVLPHFHLCPIDLVVFKGVYSF-RMGYLILRGASRLDAFSVYPFRAWLPG 64 Query: 92 CAPGGTTGTPA 60 G TG PA Sbjct: 65 YRLGSLTGAPA 75