BLASTX nr result
ID: Paeonia22_contig00037300
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00037300 (314 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007045472.1| Anthranilate synthase beta subunit 1 [Theobr... 72 8e-11 ref|XP_002878947.1| predicted protein [Arabidopsis lyrata subsp.... 72 8e-11 ref|XP_002876803.1| hypothetical protein ARALYDRAFT_484144 [Arab... 71 1e-10 ref|XP_002527548.1| Anthranilate synthase component II, putative... 70 2e-10 ref|XP_002312481.2| hypothetical protein POPTR_0008s13820g [Popu... 69 5e-10 ref|XP_004297400.1| PREDICTED: anthranilate synthase component I... 69 7e-10 ref|XP_003547656.1| PREDICTED: anthranilate synthase component 2... 69 7e-10 ref|XP_007222508.1| hypothetical protein PRUPE_ppa009800mg [Prun... 69 9e-10 ref|XP_002314761.1| anthranilate synthase beta subunit 1 family ... 69 9e-10 ref|XP_007153189.1| hypothetical protein PHAVU_003G014300g [Phas... 68 1e-09 ref|NP_200597.1| glutamine amidotransferase type 1 family protei... 68 1e-09 ref|XP_006304070.1| hypothetical protein CARUB_v10009928mg [Caps... 68 1e-09 ref|XP_002890696.1| hypothetical protein ARALYDRAFT_472860 [Arab... 68 1e-09 gb|AAM65944.1| anthranilate synthase beta chain [Arabidopsis tha... 68 1e-09 ref|XP_006469298.1| PREDICTED: anthranilate synthase component 2... 67 2e-09 ref|XP_006448093.1| hypothetical protein CICLE_v100161761mg, par... 67 2e-09 gb|ACJ84848.1| unknown [Medicago truncatula] gi|388498572|gb|AFK... 67 2e-09 ref|NP_173893.1| anthranilate synthase beta subunit 1 [Arabidops... 67 3e-09 ref|NP_001185092.1| anthranilate synthase beta subunit 1 [Arabid... 67 3e-09 ref|XP_006415834.1| hypothetical protein EUTSA_v10008447mg [Eutr... 67 3e-09 >ref|XP_007045472.1| Anthranilate synthase beta subunit 1 [Theobroma cacao] gi|508709407|gb|EOY01304.1| Anthranilate synthase beta subunit 1 [Theobroma cacao] Length = 280 Score = 72.0 bits (175), Expect = 8e-11 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = +1 Query: 1 KKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADESK 123 K YKHLQGVQFHPESIITSEGK IV NFVKLIEKKEA ES+ Sbjct: 239 KVYKHLQGVQFHPESIITSEGKTIVRNFVKLIEKKEAAESQ 279 >ref|XP_002878947.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297324786|gb|EFH55206.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 275 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/39 (79%), Positives = 38/39 (97%) Frame = +1 Query: 1 KKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADE 117 KKYKH+QGVQFHPESIIT+EGK IVGNF+KL+EKKE+++ Sbjct: 235 KKYKHIQGVQFHPESIITTEGKTIVGNFIKLVEKKESEK 273 >ref|XP_002876803.1| hypothetical protein ARALYDRAFT_484144 [Arabidopsis lyrata subsp. lyrata] gi|297322641|gb|EFH53062.1| hypothetical protein ARALYDRAFT_484144 [Arabidopsis lyrata subsp. lyrata] Length = 276 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/39 (79%), Positives = 38/39 (97%) Frame = +1 Query: 1 KKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADE 117 +KYKH+QGVQFHPESIIT+EGK IVGNF+KLIEKKE+++ Sbjct: 236 RKYKHIQGVQFHPESIITTEGKTIVGNFIKLIEKKESEK 274 >ref|XP_002527548.1| Anthranilate synthase component II, putative [Ricinus communis] gi|223533098|gb|EEF34857.1| Anthranilate synthase component II, putative [Ricinus communis] Length = 281 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +1 Query: 1 KKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEAD 114 KKYKHLQGVQFHPESIITSEGK IV NF+KL+E+KEA+ Sbjct: 241 KKYKHLQGVQFHPESIITSEGKTIVQNFIKLVERKEAE 278 >ref|XP_002312481.2| hypothetical protein POPTR_0008s13820g [Populus trichocarpa] gi|550333014|gb|EEE89848.2| hypothetical protein POPTR_0008s13820g [Populus trichocarpa] Length = 278 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +1 Query: 1 KKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEAD 114 +KYKHLQGVQFHPESIITSEGK IV NF+K+IE+KEA+ Sbjct: 238 RKYKHLQGVQFHPESIITSEGKIIVSNFIKMIERKEAE 275 >ref|XP_004297400.1| PREDICTED: anthranilate synthase component II-like [Fragaria vesca subsp. vesca] Length = 277 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +1 Query: 1 KKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEAD 114 KKYK+LQGVQFHPESIITSEG+ IVGNFVKLIEK E++ Sbjct: 237 KKYKYLQGVQFHPESIITSEGRTIVGNFVKLIEKSESE 274 >ref|XP_003547656.1| PREDICTED: anthranilate synthase component 2-like isoform 1 [Glycine max] Length = 278 Score = 68.9 bits (167), Expect = 7e-10 Identities = 34/40 (85%), Positives = 35/40 (87%) Frame = +1 Query: 1 KKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADES 120 KKYKHLQGVQFHPESIIT EGK IV NFVKLIEK+EA S Sbjct: 239 KKYKHLQGVQFHPESIITPEGKTIVRNFVKLIEKREAGGS 278 >ref|XP_007222508.1| hypothetical protein PRUPE_ppa009800mg [Prunus persica] gi|462419444|gb|EMJ23707.1| hypothetical protein PRUPE_ppa009800mg [Prunus persica] Length = 277 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +1 Query: 1 KKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEAD 114 KKY+HLQGVQFHPESIITSEGK IV NF+KLIEK+E++ Sbjct: 237 KKYRHLQGVQFHPESIITSEGKTIVRNFIKLIEKRESE 274 >ref|XP_002314761.1| anthranilate synthase beta subunit 1 family protein [Populus trichocarpa] gi|222863801|gb|EEF00932.1| anthranilate synthase beta subunit 1 family protein [Populus trichocarpa] Length = 276 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = +1 Query: 1 KKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEAD 114 +KYKHLQGVQFHPESIITSEGK IV NF+K++E+KEA+ Sbjct: 236 RKYKHLQGVQFHPESIITSEGKTIVRNFIKMVERKEAE 273 >ref|XP_007153189.1| hypothetical protein PHAVU_003G014300g [Phaseolus vulgaris] gi|561026543|gb|ESW25183.1| hypothetical protein PHAVU_003G014300g [Phaseolus vulgaris] Length = 277 Score = 68.2 bits (165), Expect = 1e-09 Identities = 34/40 (85%), Positives = 34/40 (85%) Frame = +1 Query: 1 KKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADES 120 KKYKHLQGVQFHPESIIT EGK IV NFVKLIEK EA S Sbjct: 238 KKYKHLQGVQFHPESIITPEGKKIVQNFVKLIEKMEAGGS 277 >ref|NP_200597.1| glutamine amidotransferase type 1 family protein [Arabidopsis thaliana] gi|75171068|sp|Q9FJM5.1|ASB2_ARATH RecName: Full=Anthranilate synthase beta subunit 2, chloroplastic; AltName: Full=Anthranilate synthase component 2-2; AltName: Full=Anthranilate synthase, glutamine amidotransferase component 2-2; Flags: Precursor gi|9758358|dbj|BAB08859.1| anthranilate synthase beta chain [Arabidopsis thaliana] gi|90186236|gb|ABD91494.1| At5g57890 [Arabidopsis thaliana] gi|332009585|gb|AED96968.1| glutamine amidotransferase type 1 family protein [Arabidopsis thaliana] Length = 273 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/39 (74%), Positives = 37/39 (94%) Frame = +1 Query: 1 KKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADE 117 +KYKH+QGVQFHPESIIT+EGK IV NF+KL+EKKE+++ Sbjct: 233 RKYKHIQGVQFHPESIITTEGKTIVRNFIKLVEKKESEK 271 >ref|XP_006304070.1| hypothetical protein CARUB_v10009928mg [Capsella rubella] gi|482572781|gb|EOA36968.1| hypothetical protein CARUB_v10009928mg [Capsella rubella] Length = 286 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/39 (74%), Positives = 37/39 (94%) Frame = +1 Query: 1 KKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADE 117 +KYKH+QGVQFHPESIIT+EGK IV NF+KL+EKKE+++ Sbjct: 246 RKYKHIQGVQFHPESIITTEGKTIVRNFIKLVEKKESEK 284 >ref|XP_002890696.1| hypothetical protein ARALYDRAFT_472860 [Arabidopsis lyrata subsp. lyrata] gi|297336538|gb|EFH66955.1| hypothetical protein ARALYDRAFT_472860 [Arabidopsis lyrata subsp. lyrata] Length = 277 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/39 (74%), Positives = 37/39 (94%) Frame = +1 Query: 1 KKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADE 117 +KYKH+QGVQFHPESIIT+EGK IV NF+KL+EKKE+++ Sbjct: 237 RKYKHIQGVQFHPESIITTEGKTIVRNFIKLVEKKESEK 275 >gb|AAM65944.1| anthranilate synthase beta chain [Arabidopsis thaliana] Length = 273 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/39 (74%), Positives = 37/39 (94%) Frame = +1 Query: 1 KKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADE 117 +KYKH+QGVQFHPESIIT+EGK IV NF+KL+EKKE+++ Sbjct: 233 RKYKHIQGVQFHPESIITTEGKTIVRNFIKLVEKKESEK 271 >ref|XP_006469298.1| PREDICTED: anthranilate synthase component 2-like [Citrus sinensis] Length = 283 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = +1 Query: 1 KKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADESK 123 KKYKHLQGVQFHPESIIT+EGK IV NF+K+I +KEA +S+ Sbjct: 242 KKYKHLQGVQFHPESIITTEGKTIVRNFIKMIVRKEAADSQ 282 >ref|XP_006448093.1| hypothetical protein CICLE_v100161761mg, partial [Citrus clementina] gi|557550704|gb|ESR61333.1| hypothetical protein CICLE_v100161761mg, partial [Citrus clementina] Length = 80 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = +1 Query: 1 KKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADESK 123 KKYKHLQGVQFHPESIIT+EGK IV NF+K+I +KEA +S+ Sbjct: 39 KKYKHLQGVQFHPESIITTEGKTIVRNFIKMIVRKEAADSQ 79 >gb|ACJ84848.1| unknown [Medicago truncatula] gi|388498572|gb|AFK37352.1| unknown [Medicago truncatula] Length = 270 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +1 Query: 1 KKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADES 120 KKY+H+QGVQFHPESIIT +GK IV NFVKLIEKKEA S Sbjct: 231 KKYRHMQGVQFHPESIITPDGKTIVHNFVKLIEKKEAARS 270 >ref|NP_173893.1| anthranilate synthase beta subunit 1 [Arabidopsis thaliana] gi|75102739|sp|Q42565.1|ASB1_ARATH RecName: Full=Anthranilate synthase beta subunit 1, chloroplastic; AltName: Full=Anthranilate synthase component 2-1; AltName: Full=Anthranilate synthase, glutamine amidotransferase component 2-1; AltName: Full=Protein TRYPTOPHAN BIOSYNTHESIS 4; AltName: Full=Protein WEAK ETHYLENE INSENSITIVE 7; Flags: Precursor gi|11067285|gb|AAG28813.1|AC079374_16 anthranilate synthase beta subunit [Arabidopsis thaliana] gi|403434|gb|AAA32742.1| anthranilate synthase beta subunit [Arabidopsis thaliana] gi|20466736|gb|AAM20685.1| anthranilate synthase beta subunit [Arabidopsis thaliana] gi|30023756|gb|AAP13411.1| At1g25220 [Arabidopsis thaliana] gi|110741096|dbj|BAE98642.1| hypothetical protein [Arabidopsis thaliana] gi|332192468|gb|AEE30589.1| anthranilate synthase beta subunit 1 [Arabidopsis thaliana] Length = 276 Score = 67.0 bits (162), Expect = 3e-09 Identities = 28/39 (71%), Positives = 37/39 (94%) Frame = +1 Query: 1 KKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADE 117 +KYKH+QGVQFHPESIIT+EGK IV NF+K++EKKE+++ Sbjct: 236 RKYKHIQGVQFHPESIITTEGKTIVRNFIKIVEKKESEK 274 >ref|NP_001185092.1| anthranilate synthase beta subunit 1 [Arabidopsis thaliana] gi|332192469|gb|AEE30590.1| anthranilate synthase beta subunit 1 [Arabidopsis thaliana] Length = 289 Score = 67.0 bits (162), Expect = 3e-09 Identities = 28/39 (71%), Positives = 37/39 (94%) Frame = +1 Query: 1 KKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADE 117 +KYKH+QGVQFHPESIIT+EGK IV NF+K++EKKE+++ Sbjct: 249 RKYKHIQGVQFHPESIITTEGKTIVRNFIKIVEKKESEK 287 >ref|XP_006415834.1| hypothetical protein EUTSA_v10008447mg [Eutrema salsugineum] gi|557093605|gb|ESQ34187.1| hypothetical protein EUTSA_v10008447mg [Eutrema salsugineum] Length = 275 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/38 (76%), Positives = 36/38 (94%) Frame = +1 Query: 1 KKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEAD 114 +K+KH+QGVQFHPESIIT+EGK IV NF+KL+EKKEA+ Sbjct: 235 RKHKHIQGVQFHPESIITTEGKTIVRNFIKLVEKKEAE 272