BLASTX nr result
ID: Paeonia22_contig00036936
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00036936 (318 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI17070.3| unnamed protein product [Vitis vinifera] 56 4e-06 >emb|CBI17070.3| unnamed protein product [Vitis vinifera] Length = 975 Score = 56.2 bits (134), Expect = 4e-06 Identities = 35/82 (42%), Positives = 44/82 (53%), Gaps = 2/82 (2%) Frame = +3 Query: 78 MQRRLKRPHLSASEDANKRLRPGSQN--IMKPSSMKCKPYKLQKTKLDGFHGSLHAQGAY 251 +Q RL +P+ +D KRL PG QN I P K K +K K LDG HGSLH +G Sbjct: 633 IQNRLSQPNKPGGKDTKKRLVPGPQNVHISCPVVRKHKSHKFLKRSLDGSHGSLHIEGV- 691 Query: 252 PPEAEVITTKVDPPEESEELMQ 317 P + +V + PE SEE Q Sbjct: 692 PLKTKVSAAINELPEGSEEFKQ 713