BLASTX nr result
ID: Paeonia22_contig00036783
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00036783 (482 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283327.1| PREDICTED: pentatricopeptide repeat-containi... 100 2e-19 ref|XP_007011706.1| Pentatricopeptide repeat-containing protein,... 97 2e-18 gb|EXB86664.1| hypothetical protein L484_013194 [Morus notabilis] 91 2e-16 ref|XP_002515418.1| pentatricopeptide repeat-containing protein,... 90 3e-16 ref|XP_002308709.2| hypothetical protein POPTR_0006s28060g [Popu... 89 8e-16 ref|XP_006845376.1| hypothetical protein AMTR_s00019p00039970 [A... 87 2e-15 ref|XP_004237112.1| PREDICTED: pentatricopeptide repeat-containi... 87 2e-15 ref|XP_006350217.1| PREDICTED: pentatricopeptide repeat-containi... 87 3e-15 ref|XP_006483487.1| PREDICTED: pentatricopeptide repeat-containi... 86 4e-15 ref|XP_006450275.1| hypothetical protein CICLE_v10007356mg [Citr... 86 4e-15 ref|XP_007136936.1| hypothetical protein PHAVU_009G086500g [Phas... 86 7e-15 ref|XP_003527773.1| PREDICTED: pentatricopeptide repeat-containi... 85 9e-15 ref|XP_004157129.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 83 3e-14 ref|XP_004145582.1| PREDICTED: pentatricopeptide repeat-containi... 83 3e-14 ref|XP_003603286.1| Pentatricopeptide repeat-containing protein ... 83 5e-14 gb|EYU21997.1| hypothetical protein MIMGU_mgv1a000826mg [Mimulus... 82 1e-13 ref|XP_004293246.1| PREDICTED: pentatricopeptide repeat-containi... 82 1e-13 ref|XP_004501390.1| PREDICTED: pentatricopeptide repeat-containi... 81 1e-13 gb|EMT20043.1| Pentatricopeptide repeat-containing protein [Aegi... 80 2e-13 dbj|BAJ96987.1| predicted protein [Hordeum vulgare subsp. vulgare] 80 2e-13 >ref|XP_002283327.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic [Vitis vinifera] gi|296082142|emb|CBI21147.3| unnamed protein product [Vitis vinifera] Length = 1113 Score = 100 bits (250), Expect = 2e-19 Identities = 46/59 (77%), Positives = 52/59 (88%) Frame = -1 Query: 482 GKKYKEPQLRGLKPGVFTYNTLIRGYSISGNPDRAYSVNKKMMVGGCRPNRGTFDQLPN 306 GK Y+E QL+GL+P VFTYN LIRG+S+SGNPDRAY+V KKMMVGGCRPN GTF QLPN Sbjct: 1053 GKMYEELQLKGLEPNVFTYNALIRGHSMSGNPDRAYAVYKKMMVGGCRPNTGTFAQLPN 1111 >ref|XP_007011706.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] gi|508782069|gb|EOY29325.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 1112 Score = 97.1 bits (240), Expect = 2e-18 Identities = 44/59 (74%), Positives = 50/59 (84%) Frame = -1 Query: 482 GKKYKEPQLRGLKPGVFTYNTLIRGYSISGNPDRAYSVNKKMMVGGCRPNRGTFDQLPN 306 GK Y+E QL GL+P V+TYN LIRGYS+SGNPD AY+V K+MMVGGC PNRGTF QLPN Sbjct: 1052 GKFYEELQLMGLEPNVYTYNALIRGYSVSGNPDHAYAVYKQMMVGGCSPNRGTFAQLPN 1110 >gb|EXB86664.1| hypothetical protein L484_013194 [Morus notabilis] Length = 1098 Score = 90.9 bits (224), Expect = 2e-16 Identities = 42/59 (71%), Positives = 46/59 (77%) Frame = -1 Query: 482 GKKYKEPQLRGLKPGVFTYNTLIRGYSISGNPDRAYSVNKKMMVGGCRPNRGTFDQLPN 306 G Y+E QLRGL+P VFTYN LIR YS SGNPD AY+V KKMM+GGC PN TF QLPN Sbjct: 1038 GSMYEELQLRGLEPDVFTYNALIRAYSASGNPDHAYAVYKKMMIGGCSPNVSTFAQLPN 1096 >ref|XP_002515418.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223545362|gb|EEF46867.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 1113 Score = 90.1 bits (222), Expect = 3e-16 Identities = 42/59 (71%), Positives = 47/59 (79%) Frame = -1 Query: 482 GKKYKEPQLRGLKPGVFTYNTLIRGYSISGNPDRAYSVNKKMMVGGCRPNRGTFDQLPN 306 GK Y+E Q GL+P VFTYN LIRGYS+SGN D AY+V K+MMVGGC PN GTF QLPN Sbjct: 1055 GKLYEELQFIGLEPNVFTYNALIRGYSMSGNSDSAYAVYKRMMVGGCSPNTGTFAQLPN 1113 >ref|XP_002308709.2| hypothetical protein POPTR_0006s28060g [Populus trichocarpa] gi|550337245|gb|EEE92232.2| hypothetical protein POPTR_0006s28060g [Populus trichocarpa] Length = 1115 Score = 88.6 bits (218), Expect = 8e-16 Identities = 41/59 (69%), Positives = 46/59 (77%) Frame = -1 Query: 482 GKKYKEPQLRGLKPGVFTYNTLIRGYSISGNPDRAYSVNKKMMVGGCRPNRGTFDQLPN 306 GK Y+E Q GLKP VFTYN LIRGY++SGN + AY + KKMMVGGC PN GTF QLPN Sbjct: 1055 GKIYEELQFIGLKPNVFTYNALIRGYTLSGNSELAYGIYKKMMVGGCDPNTGTFAQLPN 1113 >ref|XP_006845376.1| hypothetical protein AMTR_s00019p00039970 [Amborella trichopoda] gi|548847948|gb|ERN07051.1| hypothetical protein AMTR_s00019p00039970 [Amborella trichopoda] Length = 1123 Score = 87.4 bits (215), Expect = 2e-15 Identities = 40/59 (67%), Positives = 46/59 (77%) Frame = -1 Query: 482 GKKYKEPQLRGLKPGVFTYNTLIRGYSISGNPDRAYSVNKKMMVGGCRPNRGTFDQLPN 306 G Y+E Q +GL+P VFTYN LIR YSI+GN D AY+V KKM+VGGC PN GTF QLPN Sbjct: 1063 GAMYEELQRKGLEPNVFTYNALIRAYSIAGNTDHAYAVYKKMVVGGCEPNMGTFAQLPN 1121 >ref|XP_004237112.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like [Solanum lycopersicum] Length = 1131 Score = 87.0 bits (214), Expect = 2e-15 Identities = 40/59 (67%), Positives = 47/59 (79%) Frame = -1 Query: 482 GKKYKEPQLRGLKPGVFTYNTLIRGYSISGNPDRAYSVNKKMMVGGCRPNRGTFDQLPN 306 G+ Y+E Q GL+P VFTYN LIRGYS SG+PD AY++ +KMMVGGC PN GTF QLPN Sbjct: 1073 GRMYEELQQLGLEPDVFTYNALIRGYSKSGDPDGAYAIYEKMMVGGCSPNSGTFAQLPN 1131 >ref|XP_006350217.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like [Solanum tuberosum] Length = 1080 Score = 86.7 bits (213), Expect = 3e-15 Identities = 40/59 (67%), Positives = 47/59 (79%) Frame = -1 Query: 482 GKKYKEPQLRGLKPGVFTYNTLIRGYSISGNPDRAYSVNKKMMVGGCRPNRGTFDQLPN 306 G+ Y+E Q GL+P VFTYN LIRGYS SG+PD AY++ +KMMVGGC PN GTF QLPN Sbjct: 1022 GRMYEELQQFGLEPDVFTYNALIRGYSKSGDPDGAYAIYEKMMVGGCSPNSGTFAQLPN 1080 >ref|XP_006483487.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like [Citrus sinensis] Length = 1107 Score = 86.3 bits (212), Expect = 4e-15 Identities = 40/58 (68%), Positives = 45/58 (77%) Frame = -1 Query: 479 KKYKEPQLRGLKPGVFTYNTLIRGYSISGNPDRAYSVNKKMMVGGCRPNRGTFDQLPN 306 K Y++ Q GL+P VFTYN LIRGY SGNPD AY+V +KMMVGGC PN GTF QLPN Sbjct: 1048 KLYEQLQEMGLEPNVFTYNALIRGYGTSGNPDSAYAVYEKMMVGGCSPNPGTFAQLPN 1105 >ref|XP_006450275.1| hypothetical protein CICLE_v10007356mg [Citrus clementina] gi|557553501|gb|ESR63515.1| hypothetical protein CICLE_v10007356mg [Citrus clementina] Length = 973 Score = 86.3 bits (212), Expect = 4e-15 Identities = 40/58 (68%), Positives = 45/58 (77%) Frame = -1 Query: 479 KKYKEPQLRGLKPGVFTYNTLIRGYSISGNPDRAYSVNKKMMVGGCRPNRGTFDQLPN 306 K Y++ Q GL+P VFTYN LIRGY SGNPD AY+V +KMMVGGC PN GTF QLPN Sbjct: 914 KLYEQLQEMGLEPNVFTYNALIRGYGTSGNPDSAYAVYEKMMVGGCSPNPGTFAQLPN 971 >ref|XP_007136936.1| hypothetical protein PHAVU_009G086500g [Phaseolus vulgaris] gi|561010023|gb|ESW08930.1| hypothetical protein PHAVU_009G086500g [Phaseolus vulgaris] Length = 1106 Score = 85.5 bits (210), Expect = 7e-15 Identities = 40/59 (67%), Positives = 48/59 (81%) Frame = -1 Query: 482 GKKYKEPQLRGLKPGVFTYNTLIRGYSISGNPDRAYSVNKKMMVGGCRPNRGTFDQLPN 306 GK ++E QL GL+P VFTYN LIRG+++SGN DRA+SV KKMMV GC PN GTF QLP+ Sbjct: 1046 GKMFEELQLMGLEPNVFTYNALIRGHTMSGNKDRAFSVLKKMMVVGCSPNAGTFAQLPD 1104 >ref|XP_003527773.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like [Glycine max] Length = 1113 Score = 85.1 bits (209), Expect = 9e-15 Identities = 40/59 (67%), Positives = 46/59 (77%) Frame = -1 Query: 482 GKKYKEPQLRGLKPGVFTYNTLIRGYSISGNPDRAYSVNKKMMVGGCRPNRGTFDQLPN 306 GK ++E Q GL+P VFTYN LIRG+S SGN DRA+SV KKMM+ GC PN GTF QLPN Sbjct: 1053 GKMFEELQFMGLEPNVFTYNALIRGHSKSGNKDRAFSVFKKMMIVGCSPNAGTFAQLPN 1111 >ref|XP_004157129.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like [Cucumis sativus] Length = 1113 Score = 83.2 bits (204), Expect = 3e-14 Identities = 38/58 (65%), Positives = 45/58 (77%) Frame = -1 Query: 479 KKYKEPQLRGLKPGVFTYNTLIRGYSISGNPDRAYSVNKKMMVGGCRPNRGTFDQLPN 306 + Y+E QL GL+P VFTYN LIRGYS+S NP+ AY+V K MMV GC PN GT+ QLPN Sbjct: 1054 RMYEELQLAGLEPDVFTYNALIRGYSLSENPEHAYTVYKNMMVDGCNPNIGTYAQLPN 1111 >ref|XP_004145582.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like [Cucumis sativus] Length = 1113 Score = 83.2 bits (204), Expect = 3e-14 Identities = 38/58 (65%), Positives = 45/58 (77%) Frame = -1 Query: 479 KKYKEPQLRGLKPGVFTYNTLIRGYSISGNPDRAYSVNKKMMVGGCRPNRGTFDQLPN 306 + Y+E QL GL+P VFTYN LIRGYS+S NP+ AY+V K MMV GC PN GT+ QLPN Sbjct: 1054 RMYEELQLAGLEPDVFTYNALIRGYSLSENPEHAYTVYKNMMVDGCNPNIGTYAQLPN 1111 >ref|XP_003603286.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355492334|gb|AES73537.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 1246 Score = 82.8 bits (203), Expect = 5e-14 Identities = 40/58 (68%), Positives = 46/58 (79%) Frame = -1 Query: 479 KKYKEPQLRGLKPGVFTYNTLIRGYSISGNPDRAYSVNKKMMVGGCRPNRGTFDQLPN 306 K Y+E QL GL+P VFTYN LIRG+S+SGN D+A+SV KKMMV GC PN TF QLPN Sbjct: 1062 KMYEELQLVGLEPSVFTYNALIRGHSLSGNKDQAFSVFKKMMVVGCSPNTETFAQLPN 1119 >gb|EYU21997.1| hypothetical protein MIMGU_mgv1a000826mg [Mimulus guttatus] Length = 971 Score = 81.6 bits (200), Expect = 1e-13 Identities = 36/56 (64%), Positives = 45/56 (80%) Frame = -1 Query: 473 YKEPQLRGLKPGVFTYNTLIRGYSISGNPDRAYSVNKKMMVGGCRPNRGTFDQLPN 306 ++E Q+ GLKP VFTYN LIR +S++GNPD AY V ++M+VGGC PN GTF QLPN Sbjct: 916 FEELQIVGLKPDVFTYNALIRAHSMAGNPDHAYDVYEEMVVGGCSPNNGTFAQLPN 971 >ref|XP_004293246.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 1089 Score = 81.6 bits (200), Expect = 1e-13 Identities = 40/59 (67%), Positives = 44/59 (74%) Frame = -1 Query: 482 GKKYKEPQLRGLKPGVFTYNTLIRGYSISGNPDRAYSVNKKMMVGGCRPNRGTFDQLPN 306 G+ YKE L GL+P VFTYN LIR YS SGN D AY+V K MMVGGC PN GT+ QLPN Sbjct: 1029 GRIYKELLLTGLEPDVFTYNALIRLYSTSGNTDDAYAVYKNMMVGGCSPNVGTYAQLPN 1087 >ref|XP_004501390.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like [Cicer arietinum] Length = 1120 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/58 (67%), Positives = 45/58 (77%) Frame = -1 Query: 479 KKYKEPQLRGLKPGVFTYNTLIRGYSISGNPDRAYSVNKKMMVGGCRPNRGTFDQLPN 306 K Y+E QL GL+P VFTYN LIRG+ +SGN D+A+SV KKMMV GC PN TF QLPN Sbjct: 1061 KMYEELQLVGLEPSVFTYNALIRGHGLSGNKDQAFSVFKKMMVVGCSPNAETFAQLPN 1118 >gb|EMT20043.1| Pentatricopeptide repeat-containing protein [Aegilops tauschii] Length = 931 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/59 (59%), Positives = 45/59 (76%) Frame = -1 Query: 482 GKKYKEPQLRGLKPGVFTYNTLIRGYSISGNPDRAYSVNKKMMVGGCRPNRGTFDQLPN 306 GK Y+E +G KP VFTYN LIRGYS+SG+P+ A++ +M+VGGCRPN T+ QLPN Sbjct: 870 GKMYEELLAKGWKPNVFTYNALIRGYSVSGSPENAFAAYGRMIVGGCRPNSSTYMQLPN 928 >dbj|BAJ96987.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 1092 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/59 (59%), Positives = 45/59 (76%) Frame = -1 Query: 482 GKKYKEPQLRGLKPGVFTYNTLIRGYSISGNPDRAYSVNKKMMVGGCRPNRGTFDQLPN 306 GK Y+E +G KP VFTYN LIRGYS+SG+P+ A++ +M+VGGCRPN T+ QLPN Sbjct: 1031 GKMYEELLAKGWKPNVFTYNALIRGYSVSGSPENAFAAYGRMIVGGCRPNSSTYMQLPN 1089