BLASTX nr result
ID: Paeonia22_contig00036676
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00036676 (457 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006422261.1| hypothetical protein CICLE_v10004323mg [Citr... 57 2e-06 >ref|XP_006422261.1| hypothetical protein CICLE_v10004323mg [Citrus clementina] gi|568881878|ref|XP_006493776.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial-like [Citrus sinensis] gi|557524134|gb|ESR35501.1| hypothetical protein CICLE_v10004323mg [Citrus clementina] Length = 827 Score = 57.4 bits (137), Expect = 2e-06 Identities = 40/110 (36%), Positives = 57/110 (51%), Gaps = 10/110 (9%) Frame = +2 Query: 158 MINR-RLLRPKLLHM-FTKNHFFISSFHTIYKQSPSLPTNVVNSSCSTHNFVLNRGLSSS 331 MI R + L P+ L++ TKN F FH+ N ++ H F+ N SS Sbjct: 1 MIRRVKKLCPRNLYLSLTKNPNFRYPFHS----------NFIHHLDFNHKFIKNTSFSSR 50 Query: 332 L-------FSEIRVLCGFPNSVRDFCTGKTG-GSESNEWTEDVQYLDESG 457 L F + + PN VR +C+GK+G G + NEWTE+++YLDESG Sbjct: 51 LDYGETQNFVKDAIFFRKPNYVRSYCSGKSGDGEKCNEWTEEIEYLDESG 100