BLASTX nr result
ID: Paeonia22_contig00036521
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00036521 (700 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN67948.1| hypothetical protein VITISV_002484 [Vitis vinifera] 60 9e-07 >emb|CAN67948.1| hypothetical protein VITISV_002484 [Vitis vinifera] Length = 484 Score = 59.7 bits (143), Expect = 9e-07 Identities = 44/138 (31%), Positives = 60/138 (43%), Gaps = 10/138 (7%) Frame = +2 Query: 317 GQRESPSPPPRKQTIRSPNRFSDPREDQKKDMTDQKIVLSLEDCAILPMFNQSFEDLMR* 496 G S PP R P FS +E+Q + LS+ +LPM F+ Sbjct: 198 GAERSAKPPDR------PRSFSRRQEEQSRLELPPLTPLSISYEKLLPMIQNMFDFRW-- 249 Query: 497 L*KETFVV*PQPMIADPNPRTKNKYCKYHRDHGHKTDKCQSLMNKFEEWKEGGRMGKYL- 673 P P+ ADP+ R +K C YH++HGH T+ C+SL E+ G + +YL Sbjct: 250 ---------PGPLRADPSKRDHSKKCAYHKEHGHTTETCKSLHYLVEKLIRAGHLKQYLR 300 Query: 674 --ARA-------NGGTSR 700 AR N GTSR Sbjct: 301 SDARVRDTSRNHNSGTSR 318