BLASTX nr result
ID: Paeonia22_contig00036321
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00036321 (300 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517988.1| hypothetical protein RCOM_1176360 [Ricinus c... 65 1e-08 ref|XP_006465007.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 64 2e-08 ref|XP_006432200.1| hypothetical protein CICLE_v10000694mg [Citr... 64 2e-08 >ref|XP_002517988.1| hypothetical protein RCOM_1176360 [Ricinus communis] gi|223542970|gb|EEF44506.1| hypothetical protein RCOM_1176360 [Ricinus communis] Length = 516 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/62 (48%), Positives = 42/62 (67%) Frame = +3 Query: 33 VNSLLWVAPRLKTLSIVTDTKEISLKFMYEKIVNQKESPCYCTSLPIVCWRHCLKEVTIE 212 V SLLW+AP T++IV D++E SLKF Y + N+ + C PI+CWRH LKE+T+E Sbjct: 412 VGSLLWLAPHPDTVTIVCDSEEKSLKFKYSLVKNEVKDVFCCHLKPILCWRHNLKELTME 471 Query: 213 YY 218 + Sbjct: 472 NF 473 >ref|XP_006465007.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Citrus sinensis] Length = 536 Score = 64.3 bits (155), Expect = 2e-08 Identities = 36/87 (41%), Positives = 52/87 (59%), Gaps = 8/87 (9%) Frame = +3 Query: 30 LVNSLLWVAPRLKTLSIV---TDTKEISLKFMYEK-IVNQKESPCYCTSLPIVCWRHCLK 197 LV+ LLW+ P +TLSI + E+S +F Y+K + + E+P C SLP+ CW+HC+K Sbjct: 422 LVDCLLWITPHAETLSIEWPNINFYELSFQFSYKKKLTYEGETPSCCQSLPLSCWKHCIK 481 Query: 198 EVTIE----YYIGQRNAANVFRKDAEI 266 EV IE Y I Q N + +D +I Sbjct: 482 EVKIECTEKYPIRQINRESFSSEDGDI 508 >ref|XP_006432200.1| hypothetical protein CICLE_v10000694mg [Citrus clementina] gi|557534322|gb|ESR45440.1| hypothetical protein CICLE_v10000694mg [Citrus clementina] Length = 578 Score = 64.3 bits (155), Expect = 2e-08 Identities = 36/87 (41%), Positives = 52/87 (59%), Gaps = 8/87 (9%) Frame = +3 Query: 30 LVNSLLWVAPRLKTLSIV---TDTKEISLKFMYEK-IVNQKESPCYCTSLPIVCWRHCLK 197 LV+ LLW+ P +TLSI + E+S +F Y+K + + E+P C SLP+ CW+HC+K Sbjct: 464 LVDCLLWITPHAETLSIEWPNINFYELSFQFSYKKKLTYEGETPSCCQSLPLSCWKHCIK 523 Query: 198 EVTIE----YYIGQRNAANVFRKDAEI 266 EV IE Y I Q N + +D +I Sbjct: 524 EVKIECTEKYPIRQINRESFSSEDGDI 550