BLASTX nr result
ID: Paeonia22_contig00036240
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00036240 (342 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007226950.1| hypothetical protein PRUPE_ppa025194mg, part... 92 7e-17 ref|XP_007224256.1| hypothetical protein PRUPE_ppa018408mg, part... 92 7e-17 ref|XP_007219137.1| hypothetical protein PRUPE_ppa015965mg [Prun... 92 7e-17 ref|XP_007203318.1| hypothetical protein PRUPE_ppa019964mg, part... 92 7e-17 ref|XP_007220363.1| hypothetical protein PRUPE_ppa016496mg, part... 87 3e-15 gb|ABB55293.1| hypothetical protein 10.t00044 [Asparagus officin... 74 2e-11 gb|ABD63122.1| hypothetical protein 18.t00018 [Asparagus officin... 57 3e-06 >ref|XP_007226950.1| hypothetical protein PRUPE_ppa025194mg, partial [Prunus persica] gi|462423886|gb|EMJ28149.1| hypothetical protein PRUPE_ppa025194mg, partial [Prunus persica] Length = 1347 Score = 92.0 bits (227), Expect = 7e-17 Identities = 54/121 (44%), Positives = 73/121 (60%), Gaps = 8/121 (6%) Frame = -3 Query: 340 SMKPLKVDFKINISIYNGARDAE-LDGWLDRLETYFLVYRCSKTRRIKYASLKLLDHALI 164 S+ LK+DFK++I IY G D E LD W+D LETYF VY+ S ++IK+ASLKL HAL Sbjct: 36 SIDTLKIDFKVDIPIYKGDVDPEKLDNWVDTLETYFTVYKYSNVQKIKFASLKLSSHALT 95 Query: 163 WWKSHRKHHRTESDL*GV*MPSSQAILSCKLRRGKMIQVG-------KWQHFRQKHEQSV 5 WWKS+++ + D+ + + + KL R + VG KWQHFRQ+ Q V Sbjct: 96 WWKSYQRRY----DVSELTWKNFK-----KLLRKQFYPVGYEDERWYKWQHFRQRFGQHV 146 Query: 4 Q 2 Q Sbjct: 147 Q 147 >ref|XP_007224256.1| hypothetical protein PRUPE_ppa018408mg, partial [Prunus persica] gi|462421192|gb|EMJ25455.1| hypothetical protein PRUPE_ppa018408mg, partial [Prunus persica] Length = 1440 Score = 92.0 bits (227), Expect = 7e-17 Identities = 54/121 (44%), Positives = 73/121 (60%), Gaps = 8/121 (6%) Frame = -3 Query: 340 SMKPLKVDFKINISIYNGARDAE-LDGWLDRLETYFLVYRCSKTRRIKYASLKLLDHALI 164 S+ LK+DFK++I IY G D E LD W+D LETYF VY+ S ++IK+ASLKL HAL Sbjct: 107 SIDTLKIDFKVDIPIYKGDIDPEKLDNWVDTLETYFTVYKYSNVQKIKFASLKLSSHALT 166 Query: 163 WWKSHRKHHRTESDL*GV*MPSSQAILSCKLRRGKMIQVG-------KWQHFRQKHEQSV 5 WWKS+++ + D+ + + + KL R + VG KWQHFRQ+ Q V Sbjct: 167 WWKSYQRRY----DVSELTWKNFK-----KLLRKQFYPVGYEDERWYKWQHFRQRFGQHV 217 Query: 4 Q 2 Q Sbjct: 218 Q 218 >ref|XP_007219137.1| hypothetical protein PRUPE_ppa015965mg [Prunus persica] gi|462415599|gb|EMJ20336.1| hypothetical protein PRUPE_ppa015965mg [Prunus persica] Length = 1484 Score = 92.0 bits (227), Expect = 7e-17 Identities = 54/121 (44%), Positives = 73/121 (60%), Gaps = 8/121 (6%) Frame = -3 Query: 340 SMKPLKVDFKINISIYNGARDAE-LDGWLDRLETYFLVYRCSKTRRIKYASLKLLDHALI 164 S+ LK+DFK++I IY G D E LD W+D LETYF VY+ S ++IK+ASLKL HAL Sbjct: 117 SIDTLKIDFKVDIPIYKGDIDPEKLDNWVDTLETYFTVYKYSNVQKIKFASLKLSSHALT 176 Query: 163 WWKSHRKHHRTESDL*GV*MPSSQAILSCKLRRGKMIQVG-------KWQHFRQKHEQSV 5 WWKS+++ + D+ + + + KL R + VG KWQHFRQ+ Q V Sbjct: 177 WWKSYQRRY----DVSELTWKNFK-----KLLRKQFYPVGYEDERWYKWQHFRQRFGQHV 227 Query: 4 Q 2 Q Sbjct: 228 Q 228 >ref|XP_007203318.1| hypothetical protein PRUPE_ppa019964mg, partial [Prunus persica] gi|462398849|gb|EMJ04517.1| hypothetical protein PRUPE_ppa019964mg, partial [Prunus persica] Length = 1488 Score = 92.0 bits (227), Expect = 7e-17 Identities = 54/121 (44%), Positives = 73/121 (60%), Gaps = 8/121 (6%) Frame = -3 Query: 340 SMKPLKVDFKINISIYNGARDAE-LDGWLDRLETYFLVYRCSKTRRIKYASLKLLDHALI 164 S+ LK+DFK++I IY G D E LD W+D LETYF VY+ S ++IK+ASLKL HAL Sbjct: 107 SIDTLKIDFKVDIPIYKGDVDPEKLDNWVDTLETYFTVYKYSNVQKIKFASLKLSSHALT 166 Query: 163 WWKSHRKHHRTESDL*GV*MPSSQAILSCKLRRGKMIQVG-------KWQHFRQKHEQSV 5 WWKS+++ + D+ + + + KL R + VG KWQHFRQ+ Q V Sbjct: 167 WWKSYQRRY----DVSELTWKNFK-----KLLRKQFYPVGYEDERWYKWQHFRQRFGQHV 217 Query: 4 Q 2 Q Sbjct: 218 Q 218 >ref|XP_007220363.1| hypothetical protein PRUPE_ppa016496mg, partial [Prunus persica] gi|462416825|gb|EMJ21562.1| hypothetical protein PRUPE_ppa016496mg, partial [Prunus persica] Length = 373 Score = 86.7 bits (213), Expect = 3e-15 Identities = 50/115 (43%), Positives = 69/115 (60%), Gaps = 8/115 (6%) Frame = -3 Query: 322 VDFKINISIYNGARDAE-LDGWLDRLETYFLVYRCSKTRRIKYASLKLLDHALIWWKSHR 146 +DFK++I IY G D E LD W+D LETYF VY+ S ++IK+AS+KL HAL WWKS++ Sbjct: 1 IDFKVDIPIYKGDVDPEKLDNWVDTLETYFTVYKYSNVQKIKFASMKLSSHALTWWKSYQ 60 Query: 145 KHHRTESDL*GV*MPSSQAILSCKLRRGKMIQVG-------KWQHFRQKHEQSVQ 2 + + D+ + + + KL R + VG KWQHFRQ+ Q VQ Sbjct: 61 RRY----DVSELTWKNFK-----KLLRKQFYPVGYEDERWYKWQHFRQRFGQHVQ 106 >gb|ABB55293.1| hypothetical protein 10.t00044 [Asparagus officinalis] Length = 176 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/70 (48%), Positives = 48/70 (68%), Gaps = 1/70 (1%) Frame = -3 Query: 340 SMKPLKVDFKINISIYNGARDAE-LDGWLDRLETYFLVYRCSKTRRIKYASLKLLDHALI 164 S + LK+DFK+ I IY+G+ D E LD W++R+ETYF +Y S +I + +LKL HAL Sbjct: 103 SYQNLKIDFKVEILIYDGSVDVERLDDWIERMETYFTLYGYSSKEKIVFTTLKLSGHALT 162 Query: 163 WWKSHRKHHR 134 WWKS+ K + Sbjct: 163 WWKSYCKQEK 172 >gb|ABD63122.1| hypothetical protein 18.t00018 [Asparagus officinalis] Length = 189 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/59 (42%), Positives = 41/59 (69%), Gaps = 1/59 (1%) Frame = -3 Query: 340 SMKPLKVDFKINISIYNGARDAE-LDGWLDRLETYFLVYRCSKTRRIKYASLKLLDHAL 167 S + LK+ FK+ IS+Y+G+ + E D W++R+ETYF++Y S ++ + +LKL HAL Sbjct: 129 SYQNLKIGFKVEISVYDGSVNVERFDDWIERMETYFILYGYSSKEKLVFVTLKLSGHAL 187