BLASTX nr result
ID: Paeonia22_contig00036098
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00036098 (242 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007137038.1| hypothetical protein PHAVU_009G094500g [Phas... 55 8e-06 >ref|XP_007137038.1| hypothetical protein PHAVU_009G094500g [Phaseolus vulgaris] gi|561010125|gb|ESW09032.1| hypothetical protein PHAVU_009G094500g [Phaseolus vulgaris] Length = 412 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/63 (42%), Positives = 41/63 (65%), Gaps = 1/63 (1%) Frame = -2 Query: 238 LGDNIEVVNLFNNFSEEIELAKYSNRYYKLSEDLNAFC-SLFNGLKTSLIRGYFNTPWRA 62 LG++ V N+FN+ + I +S++Y+ L DLNAFC + N L+++L R Y NTPW+ Sbjct: 328 LGESDSVANMFNSLWKNITHINFSSQYFVLCRDLNAFCGNPLNKLQSTLRRDYCNTPWQT 387 Query: 61 ATS 53 A S Sbjct: 388 AVS 390