BLASTX nr result
ID: Paeonia22_contig00036064
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00036064 (332 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526718.1| nucleic acid binding protein, putative [Rici... 55 8e-06 >ref|XP_002526718.1| nucleic acid binding protein, putative [Ricinus communis] gi|223533907|gb|EEF35632.1| nucleic acid binding protein, putative [Ricinus communis] Length = 728 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/46 (60%), Positives = 34/46 (73%), Gaps = 1/46 (2%) Frame = -2 Query: 193 ADISRSCGLNKSTSLPCVVSGGYAKVLD-VKPMLLAGADPCSTDVN 59 AD++RSCGL+KST+L CV SGG +D VK +L AGADP S D N Sbjct: 113 ADVNRSCGLDKSTALHCVASGGAVNAVDVVKLLLAAGADPNSIDAN 158