BLASTX nr result
ID: Paeonia22_contig00035988
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00035988 (208 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285089.1| PREDICTED: uncharacterized protein LOC100266... 69 9e-10 ref|XP_002873986.1| hypothetical protein ARALYDRAFT_351112 [Arab... 65 1e-08 emb|CBI38915.3| unnamed protein product [Vitis vinifera] 65 1e-08 ref|XP_002524467.1| hypothetical protein RCOM_0221540 [Ricinus c... 64 2e-08 ref|XP_006475818.1| PREDICTED: mediator of RNA polymerase II tra... 64 3e-08 ref|XP_006450970.1| hypothetical protein CICLE_v10007689mg [Citr... 64 3e-08 ref|XP_006400585.1| hypothetical protein EUTSA_v10012923mg [Eutr... 63 5e-08 ref|XP_007204608.1| hypothetical protein PRUPE_ppa002594mg [Prun... 62 6e-08 ref|XP_006374395.1| hypothetical protein POPTR_0015s06780g [Popu... 62 6e-08 ref|NP_197517.3| RNA polymerase II transcription mediator [Arabi... 62 6e-08 gb|EXB54541.1| hypothetical protein L484_006289 [Morus notabilis] 62 8e-08 ref|XP_004141551.1| PREDICTED: mediator of RNA polymerase II tra... 62 8e-08 ref|XP_006286416.1| hypothetical protein CARUB_v10002972mg [Caps... 60 2e-07 ref|XP_004300164.1| PREDICTED: mediator of RNA polymerase II tra... 60 4e-07 ref|XP_004251571.1| PREDICTED: mediator of RNA polymerase II tra... 60 4e-07 gb|EYU29301.1| hypothetical protein MIMGU_mgv1a002570mg [Mimulus... 59 5e-07 ref|XP_006364902.1| PREDICTED: mediator of RNA polymerase II tra... 58 2e-06 ref|XP_007154971.1| hypothetical protein PHAVU_003G161800g [Phas... 58 2e-06 ref|XP_007013390.1| RNA polymerase II transcription mediators is... 57 2e-06 ref|XP_003549778.1| PREDICTED: mediator of RNA polymerase II tra... 57 3e-06 >ref|XP_002285089.1| PREDICTED: uncharacterized protein LOC100266409 [Vitis vinifera] gi|147821405|emb|CAN63500.1| hypothetical protein VITISV_011675 [Vitis vinifera] gi|297738929|emb|CBI28174.3| unnamed protein product [Vitis vinifera] Length = 660 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 102 DSNMEISLDKLPVKRLDAIEENGAERFPTDVGYDE 206 D MEISLDKLP+KRLDAIEENGAERFPTDVGYD+ Sbjct: 2 DGKMEISLDKLPIKRLDAIEENGAERFPTDVGYDD 36 >ref|XP_002873986.1| hypothetical protein ARALYDRAFT_351112 [Arabidopsis lyrata subsp. lyrata] gi|297319823|gb|EFH50245.1| hypothetical protein ARALYDRAFT_351112 [Arabidopsis lyrata subsp. lyrata] Length = 652 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/35 (80%), Positives = 35/35 (100%) Frame = +3 Query: 102 DSNMEISLDKLPVKRLDAIEENGAERFPTDVGYDE 206 DS+MEISLD+LP+KRL++IEENGAERFP+DVGYD+ Sbjct: 2 DSDMEISLDRLPIKRLESIEENGAERFPSDVGYDD 36 >emb|CBI38915.3| unnamed protein product [Vitis vinifera] Length = 269 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 111 MEISLDKLPVKRLDAIEENGAERFPTDVGYDE 206 MEISLDKLP+KRLDAIEENG ERFPTDVGYD+ Sbjct: 70 MEISLDKLPIKRLDAIEENGVERFPTDVGYDD 101 >ref|XP_002524467.1| hypothetical protein RCOM_0221540 [Ricinus communis] gi|223536255|gb|EEF37907.1| hypothetical protein RCOM_0221540 [Ricinus communis] Length = 407 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +3 Query: 102 DSNMEISLDKLPVKRLDAIEENGAERFPTDVGYDE 206 + +EISLDKLPVKRL+AIEENG ERFPTDVGYDE Sbjct: 2 EGKVEISLDKLPVKRLEAIEENGVERFPTDVGYDE 36 >ref|XP_006475818.1| PREDICTED: mediator of RNA polymerase II transcription subunit 17-like [Citrus sinensis] Length = 657 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +3 Query: 102 DSNMEISLDKLPVKRLDAIEENGAERFPTDVGYDE 206 + N+EIS+DKLPVKRLDAIEE GAERFP DVGYDE Sbjct: 2 NGNLEISVDKLPVKRLDAIEETGAERFPPDVGYDE 36 >ref|XP_006450970.1| hypothetical protein CICLE_v10007689mg [Citrus clementina] gi|557554196|gb|ESR64210.1| hypothetical protein CICLE_v10007689mg [Citrus clementina] Length = 657 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +3 Query: 102 DSNMEISLDKLPVKRLDAIEENGAERFPTDVGYDE 206 + N+EIS+DKLPVKRLDAIEE GAERFP DVGYDE Sbjct: 2 NGNLEISVDKLPVKRLDAIEETGAERFPPDVGYDE 36 >ref|XP_006400585.1| hypothetical protein EUTSA_v10012923mg [Eutrema salsugineum] gi|557101675|gb|ESQ42038.1| hypothetical protein EUTSA_v10012923mg [Eutrema salsugineum] Length = 650 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/35 (77%), Positives = 34/35 (97%) Frame = +3 Query: 102 DSNMEISLDKLPVKRLDAIEENGAERFPTDVGYDE 206 DS+MEISLD+LP+KRL++IEENGAERFP+DV YD+ Sbjct: 2 DSDMEISLDRLPIKRLESIEENGAERFPSDVNYDD 36 >ref|XP_007204608.1| hypothetical protein PRUPE_ppa002594mg [Prunus persica] gi|462400139|gb|EMJ05807.1| hypothetical protein PRUPE_ppa002594mg [Prunus persica] Length = 654 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 102 DSNMEISLDKLPVKRLDAIEENGAERFPTDVGYDE 206 D MEISLDKLP+KRLD IEENG ERFP DVGY+E Sbjct: 2 DGKMEISLDKLPIKRLDVIEENGLERFPPDVGYEE 36 >ref|XP_006374395.1| hypothetical protein POPTR_0015s06780g [Populus trichocarpa] gi|550322157|gb|ERP52192.1| hypothetical protein POPTR_0015s06780g [Populus trichocarpa] Length = 667 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +3 Query: 102 DSNMEISLDKLPVKRLDAIEENGAERFPTDVGYDE 206 D +E+SLDKLPVKRL++IEENG ERFPTD+GYDE Sbjct: 2 DGKLEMSLDKLPVKRLESIEENGFERFPTDIGYDE 36 >ref|NP_197517.3| RNA polymerase II transcription mediator [Arabidopsis thaliana] gi|395406781|sp|F4K460.1|MED17_ARATH RecName: Full=Mediator of RNA polymerase II transcription subunit 17 gi|332005425|gb|AED92808.1| RNA polymerase II transcription mediator [Arabidopsis thaliana] Length = 653 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/35 (77%), Positives = 34/35 (97%) Frame = +3 Query: 102 DSNMEISLDKLPVKRLDAIEENGAERFPTDVGYDE 206 DS+MEISLD+LP+KRL++IEENGAERFP+DV YD+ Sbjct: 2 DSDMEISLDRLPIKRLESIEENGAERFPSDVDYDD 36 >gb|EXB54541.1| hypothetical protein L484_006289 [Morus notabilis] Length = 701 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +3 Query: 102 DSNMEISLDKLPVKRLDAIEENGAERFPTDVGYDE 206 + +++SLDKLPVKRLD IEENGAERFP+DVGYDE Sbjct: 2 NEKVQVSLDKLPVKRLDVIEENGAERFPSDVGYDE 36 >ref|XP_004141551.1| PREDICTED: mediator of RNA polymerase II transcription subunit 17-like [Cucumis sativus] gi|449481525|ref|XP_004156208.1| PREDICTED: mediator of RNA polymerase II transcription subunit 17-like [Cucumis sativus] Length = 662 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = +3 Query: 102 DSNMEISLDKLPVKRLDAIEENGAERFPTDVGYDE 206 D +M++SLDKLPVKRL+AIEENG ERFP+DVGY+E Sbjct: 2 DEDMKVSLDKLPVKRLEAIEENGLERFPSDVGYEE 36 >ref|XP_006286416.1| hypothetical protein CARUB_v10002972mg [Capsella rubella] gi|482555122|gb|EOA19314.1| hypothetical protein CARUB_v10002972mg [Capsella rubella] Length = 651 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/35 (74%), Positives = 33/35 (94%) Frame = +3 Query: 102 DSNMEISLDKLPVKRLDAIEENGAERFPTDVGYDE 206 DS+MEISLD+LP+KRL++IEENGAE FP+DV YD+ Sbjct: 2 DSDMEISLDRLPIKRLESIEENGAEHFPSDVDYDD 36 >ref|XP_004300164.1| PREDICTED: mediator of RNA polymerase II transcription subunit 17-like [Fragaria vesca subsp. vesca] Length = 655 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +3 Query: 102 DSNMEISLDKLPVKRLDAIEENGAERFPTDVGYDE 206 D +EISLDKLP+KRLD IEENG ERFP +VGY+E Sbjct: 2 DGKLEISLDKLPIKRLDVIEENGLERFPPEVGYEE 36 >ref|XP_004251571.1| PREDICTED: mediator of RNA polymerase II transcription subunit 17-like [Solanum lycopersicum] Length = 663 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = +3 Query: 102 DSNMEISLDKLPVKRLDAIEENGAERFPTDVGYDE 206 + N+EIS+DKLP+KRL+ IEE GAERFP+D+GYDE Sbjct: 2 NGNLEISVDKLPIKRLEYIEEQGAERFPSDIGYDE 36 >gb|EYU29301.1| hypothetical protein MIMGU_mgv1a002570mg [Mimulus guttatus] Length = 657 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = +3 Query: 102 DSNMEISLDKLPVKRLDAIEENGAERFPTDVGYDE 206 D N+EISLDKLP+KRL++IEE G+ERFP+DV YDE Sbjct: 2 DGNLEISLDKLPIKRLESIEEFGSERFPSDVDYDE 36 >ref|XP_006364902.1| PREDICTED: mediator of RNA polymerase II transcription subunit 17-like [Solanum tuberosum] Length = 663 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/35 (68%), Positives = 32/35 (91%) Frame = +3 Query: 102 DSNMEISLDKLPVKRLDAIEENGAERFPTDVGYDE 206 + ++EIS+DKLP+KRL+ IEE GAERFP+D+GYDE Sbjct: 2 NGDLEISVDKLPIKRLEFIEEQGAERFPSDIGYDE 36 >ref|XP_007154971.1| hypothetical protein PHAVU_003G161800g [Phaseolus vulgaris] gi|561028325|gb|ESW26965.1| hypothetical protein PHAVU_003G161800g [Phaseolus vulgaris] Length = 663 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/37 (75%), Positives = 31/37 (83%), Gaps = 2/37 (5%) Frame = +3 Query: 102 DSNME--ISLDKLPVKRLDAIEENGAERFPTDVGYDE 206 D NM+ ISLDKLP+KRLD+IEENG ERFP DV YDE Sbjct: 2 DDNMDLQISLDKLPIKRLDSIEENGMERFPPDVDYDE 38 >ref|XP_007013390.1| RNA polymerase II transcription mediators isoform 1 [Theobroma cacao] gi|590578008|ref|XP_007013391.1| RNA polymerase II transcription mediators isoform 1 [Theobroma cacao] gi|508783753|gb|EOY31009.1| RNA polymerase II transcription mediators isoform 1 [Theobroma cacao] gi|508783754|gb|EOY31010.1| RNA polymerase II transcription mediators isoform 1 [Theobroma cacao] Length = 663 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +3 Query: 102 DSNMEISLDKLPVKRLDAIEENGAERFPTDVGYDE 206 D N+EISLDKLPV+ LDAIEENG ER+P ++ YDE Sbjct: 2 DGNLEISLDKLPVRALDAIEENGVERYPHELSYDE 36 >ref|XP_003549778.1| PREDICTED: mediator of RNA polymerase II transcription subunit 17-like isoform X1 [Glycine max] gi|571535792|ref|XP_006600757.1| PREDICTED: mediator of RNA polymerase II transcription subunit 17-like isoform X2 [Glycine max] Length = 660 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +3 Query: 111 MEISLDKLPVKRLDAIEENGAERFPTDVGYDE 206 ++ISLDKLP+KRLD+IEENG ERFP DV YDE Sbjct: 7 LQISLDKLPIKRLDSIEENGIERFPLDVDYDE 38