BLASTX nr result
ID: Paeonia22_contig00035884
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00035884 (427 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002316296.1| methionyl-tRNA synthetase family protein [Po... 59 5e-07 ref|XP_002279143.2| PREDICTED: methionyl-tRNA synthetase-like [V... 58 1e-06 ref|XP_003589083.1| Methionyl-tRNA synthetase [Medicago truncatu... 58 2e-06 ref|XP_007220550.1| hypothetical protein PRUPE_ppa003202mg [Prun... 57 2e-06 ref|XP_006436029.1| hypothetical protein CICLE_v10030995mg [Citr... 57 3e-06 ref|XP_007009384.1| Methionyl-tRNA synthetase / methionine--tRNA... 57 3e-06 ref|XP_004304645.1| PREDICTED: methionine--tRNA ligase-like [Fra... 57 3e-06 ref|XP_007142726.1| hypothetical protein PHAVU_007G011800g [Phas... 56 6e-06 ref|XP_003558528.1| PREDICTED: methionyl-tRNA synthetase-like [B... 55 8e-06 ref|XP_003555819.1| PREDICTED: methionine--tRNA ligase, mitochon... 55 8e-06 ref|XP_006651159.1| PREDICTED: methionine--tRNA ligase, mitochon... 55 1e-05 tpg|DAA43858.1| TPA: hypothetical protein ZEAMMB73_548614 [Zea m... 55 1e-05 tpg|DAA43857.1| TPA: hypothetical protein ZEAMMB73_548614 [Zea m... 55 1e-05 ref|XP_003536765.1| PREDICTED: methionine--tRNA ligase, mitochon... 55 1e-05 ref|XP_002465664.1| hypothetical protein SORBIDRAFT_01g043330 [S... 55 1e-05 >ref|XP_002316296.1| methionyl-tRNA synthetase family protein [Populus trichocarpa] gi|222865336|gb|EEF02467.1| methionyl-tRNA synthetase family protein [Populus trichocarpa] Length = 610 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +1 Query: 223 KELIKIRCFSIHIKPCVLRREDNDFFALSKYQKQLEEN 336 KEL+ +C H+KPC+ R+EDN FFALSKYQKQLEEN Sbjct: 202 KELLDNKCCPTHLKPCIERKEDNYFFALSKYQKQLEEN 239 >ref|XP_002279143.2| PREDICTED: methionyl-tRNA synthetase-like [Vitis vinifera] gi|296086256|emb|CBI31697.3| unnamed protein product [Vitis vinifera] Length = 611 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +1 Query: 223 KELIKIRCFSIHIKPCVLRREDNDFFALSKYQKQLEE 333 KEL++ C +H+KPCVLR+EDN FFALSKYQK LEE Sbjct: 202 KELLENNCCPMHLKPCVLRKEDNYFFALSKYQKLLEE 238 >ref|XP_003589083.1| Methionyl-tRNA synthetase [Medicago truncatula] gi|355478131|gb|AES59334.1| Methionyl-tRNA synthetase [Medicago truncatula] Length = 540 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +1 Query: 223 KELIKIRCFSIHIKPCVLRREDNDFFALSKYQKQLEE 333 KEL++ C IH+KPCV R+EDN FFALSKYQK LEE Sbjct: 194 KELLENNCCPIHLKPCVSRKEDNYFFALSKYQKSLEE 230 >ref|XP_007220550.1| hypothetical protein PRUPE_ppa003202mg [Prunus persica] gi|462417012|gb|EMJ21749.1| hypothetical protein PRUPE_ppa003202mg [Prunus persica] Length = 593 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = +1 Query: 223 KELIKIRCFSIHIKPCVLRREDNDFFALSKYQKQLEE 333 KEL+ C S H+KPCV R+EDN FFALSKYQK LEE Sbjct: 185 KELLDNNCCSTHLKPCVARKEDNYFFALSKYQKSLEE 221 >ref|XP_006436029.1| hypothetical protein CICLE_v10030995mg [Citrus clementina] gi|568865434|ref|XP_006486080.1| PREDICTED: methionine--tRNA ligase, mitochondrial-like [Citrus sinensis] gi|557538225|gb|ESR49269.1| hypothetical protein CICLE_v10030995mg [Citrus clementina] Length = 607 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = +1 Query: 223 KELIKIRCFSIHIKPCVLRREDNDFFALSKYQKQLEE 333 KEL++ +C IH+KPCV R+EDN FFALSKYQK LE+ Sbjct: 196 KELLENQCCPIHLKPCVARKEDNYFFALSKYQKLLED 232 >ref|XP_007009384.1| Methionyl-tRNA synthetase / methionine--tRNA ligase / MetRS (cpMetRS) [Theobroma cacao] gi|508726297|gb|EOY18194.1| Methionyl-tRNA synthetase / methionine--tRNA ligase / MetRS (cpMetRS) [Theobroma cacao] Length = 612 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = +1 Query: 223 KELIKIRCFSIHIKPCVLRREDNDFFALSKYQKQLEE 333 KEL++ C H+KPCV RREDN FFALSKYQK LEE Sbjct: 203 KELLENNCCPTHLKPCVHRREDNYFFALSKYQKSLEE 239 >ref|XP_004304645.1| PREDICTED: methionine--tRNA ligase-like [Fragaria vesca subsp. vesca] Length = 590 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = +1 Query: 223 KELIKIRCFSIHIKPCVLRREDNDFFALSKYQKQLEE 333 KEL++ C H+KPCV R+EDN FFALSKYQK+LEE Sbjct: 180 KELLENNCCPTHLKPCVARKEDNFFFALSKYQKRLEE 216 >ref|XP_007142726.1| hypothetical protein PHAVU_007G011800g [Phaseolus vulgaris] gi|561015916|gb|ESW14720.1| hypothetical protein PHAVU_007G011800g [Phaseolus vulgaris] Length = 608 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = +1 Query: 223 KELIKIRCFSIHIKPCVLRREDNDFFALSKYQKQLEE 333 KEL+ C +H+KPCV R+EDN FFALSKYQK LEE Sbjct: 196 KELLDNSCCPVHLKPCVSRKEDNYFFALSKYQKALEE 232 >ref|XP_003558528.1| PREDICTED: methionyl-tRNA synthetase-like [Brachypodium distachyon] Length = 600 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = +1 Query: 223 KELIKIRCFSIHIKPCVLRREDNDFFALSKYQKQLEE 333 KEL++ C +H+KPCV R+EDN FFALSKYQ +LEE Sbjct: 193 KELVENNCCPVHLKPCVPRKEDNYFFALSKYQHKLEE 229 >ref|XP_003555819.1| PREDICTED: methionine--tRNA ligase, mitochondrial-like [Glycine max] Length = 605 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/41 (58%), Positives = 31/41 (75%) Frame = +1 Query: 223 KELIKIRCFSIHIKPCVLRREDNDFFALSKYQKQLEEN*FK 345 KEL+ C +H+KPCV R+EDN FFALSKYQK LE+ ++ Sbjct: 196 KELLDNNCCPVHLKPCVSRKEDNYFFALSKYQKALEDTLYR 236 >ref|XP_006651159.1| PREDICTED: methionine--tRNA ligase, mitochondrial-like, partial [Oryza brachyantha] Length = 560 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = +1 Query: 223 KELIKIRCFSIHIKPCVLRREDNDFFALSKYQKQLEE 333 KEL + +C +H+KPCV R+EDN FFALSKYQ QLE+ Sbjct: 153 KELAENKCCPVHLKPCVPRKEDNYFFALSKYQHQLED 189 >tpg|DAA43858.1| TPA: hypothetical protein ZEAMMB73_548614 [Zea mays] Length = 599 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = +1 Query: 223 KELIKIRCFSIHIKPCVLRREDNDFFALSKYQKQLEE 333 KEL++ C +H+KPCV R+EDN FFALSKYQ +LEE Sbjct: 193 KELLENNCCPVHLKPCVERKEDNYFFALSKYQHKLEE 229 >tpg|DAA43857.1| TPA: hypothetical protein ZEAMMB73_548614 [Zea mays] Length = 549 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = +1 Query: 223 KELIKIRCFSIHIKPCVLRREDNDFFALSKYQKQLEE 333 KEL++ C +H+KPCV R+EDN FFALSKYQ +LEE Sbjct: 193 KELLENNCCPVHLKPCVERKEDNYFFALSKYQHKLEE 229 >ref|XP_003536765.1| PREDICTED: methionine--tRNA ligase, mitochondrial-like [Glycine max] Length = 605 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/37 (64%), Positives = 29/37 (78%) Frame = +1 Query: 223 KELIKIRCFSIHIKPCVLRREDNDFFALSKYQKQLEE 333 KEL+ C +H+KPCV R+EDN FFALSKYQK LE+ Sbjct: 196 KELLDNNCCPVHLKPCVSRKEDNYFFALSKYQKALED 232 >ref|XP_002465664.1| hypothetical protein SORBIDRAFT_01g043330 [Sorghum bicolor] gi|241919518|gb|EER92662.1| hypothetical protein SORBIDRAFT_01g043330 [Sorghum bicolor] Length = 597 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = +1 Query: 223 KELIKIRCFSIHIKPCVLRREDNDFFALSKYQKQLEE 333 KEL++ C +H+KPCV R+EDN FFALSKYQ +LEE Sbjct: 193 KELLENNCCPVHLKPCVERKEDNYFFALSKYQHKLEE 229