BLASTX nr result
ID: Paeonia22_contig00035708
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00035708 (326 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN72171.1| hypothetical protein VITISV_036207 [Vitis vinifera] 59 9e-07 >emb|CAN72171.1| hypothetical protein VITISV_036207 [Vitis vinifera] Length = 1096 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +3 Query: 3 RSELNLADPLTKPLDRRLVVELSRGMGLMPIS*DESDSNPTY 128 RS+LNLAD LTKPL+++LV E SRGMGLMPI+ +S NPTY Sbjct: 1055 RSKLNLADSLTKPLNKKLVEETSRGMGLMPITEVKSCGNPTY 1096