BLASTX nr result
ID: Paeonia22_contig00035560
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00035560 (391 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABV65225.1| NADH-plastoquinone oxidoreductase subunit 5, part... 82 8e-14 gb|AAS68438.1| NADH dehydrogenase subunit F [Qualea sp. KJS-2004] 82 8e-14 gb|ACX80165.1| NADH dehydrogenase subunit F [Cyanostegia angusti... 81 1e-13 gb|ABP35772.1| NADH dehydrogenase subunit F [Godmania aesculifolia] 81 2e-13 gb|AHI49020.1| NADH dehydrogenase subunit 5, partial (chloroplas... 80 2e-13 gb|AGV40988.1| NADH dehydrogenase subunit F, partial (chloroplas... 80 2e-13 gb|AGH56002.1| NADH dehydrogenase subunit F, partial (chloroplas... 80 2e-13 gb|AGH56001.1| NADH dehydrogenase subunit F, partial (chloroplas... 80 2e-13 gb|AGH56000.1| NADH dehydrogenase subunit F, partial (chloroplas... 80 2e-13 gb|AFB83629.1| NADH dehydrogenase subunit F, partial (chloroplas... 80 2e-13 gb|AFB83614.1| NADH dehydrogenase subunit F, partial (chloroplas... 80 2e-13 gb|AFB83613.1| NADH dehydrogenase subunit F, partial (chloroplas... 80 2e-13 gb|AFB83601.1| NADH dehydrogenase subunit F, partial (chloroplas... 80 2e-13 gb|AFB83600.1| NADH dehydrogenase subunit F, partial (chloroplas... 80 2e-13 gb|AFB83598.1| NADH dehydrogenase subunit F, partial (chloroplas... 80 2e-13 gb|AFB83596.1| NADH dehydrogenase subunit F, partial (chloroplas... 80 2e-13 gb|AFB83594.1| NADH dehydrogenase subunit F, partial (chloroplas... 80 2e-13 gb|AFB83593.1| NADH dehydrogenase subunit F, partial (chloroplas... 80 2e-13 gb|AFB83592.1| NADH dehydrogenase subunit F, partial (chloroplas... 80 2e-13 gb|AFB83590.1| NADH dehydrogenase subunit F, partial (chloroplas... 80 2e-13 >gb|ABV65225.1| NADH-plastoquinone oxidoreductase subunit 5, partial (chloroplast) [Qualea parviflora] Length = 690 Score = 82.0 bits (201), Expect = 8e-14 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 220 HMPITKTSF*LGTLTLCGIPPLAYFWSNNEILSDNWLYSPIFA 348 H+PITKTSF +GTL+LCGIPPLA+FWS NEIL+D+WLYSPIFA Sbjct: 375 HVPITKTSFVIGTLSLCGIPPLAWFWSKNEILNDSWLYSPIFA 417 >gb|AAS68438.1| NADH dehydrogenase subunit F [Qualea sp. KJS-2004] Length = 363 Score = 82.0 bits (201), Expect = 8e-14 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 220 HMPITKTSF*LGTLTLCGIPPLAYFWSNNEILSDNWLYSPIFA 348 H+PITKTSF +GTL+LCGIPPLA+FWS NEIL+D+WLYSPIFA Sbjct: 48 HVPITKTSFVIGTLSLCGIPPLAWFWSKNEILNDSWLYSPIFA 90 >gb|ACX80165.1| NADH dehydrogenase subunit F [Cyanostegia angustifolia] Length = 380 Score = 81.3 bits (199), Expect = 1e-13 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = +1 Query: 220 HMPITKTSF*LGTLTLCGIPPLAYFWSNNEILSDNWLYSPIFA 348 H+PITKTSF LGTL+LCGIPPLA FWS +EIL+DNWLYSPIFA Sbjct: 82 HVPITKTSFLLGTLSLCGIPPLACFWSKDEILNDNWLYSPIFA 124 >gb|ABP35772.1| NADH dehydrogenase subunit F [Godmania aesculifolia] Length = 698 Score = 80.9 bits (198), Expect = 2e-13 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +1 Query: 220 HMPITKTSF*LGTLTLCGIPPLAYFWSNNEILSDNWLYSPIFA 348 H+PITKTSF LGTL+LCGIPPLA+FWS +EIL+D+WLYSPIFA Sbjct: 382 HVPITKTSFLLGTLSLCGIPPLAWFWSKDEILNDSWLYSPIFA 424 >gb|AHI49020.1| NADH dehydrogenase subunit 5, partial (chloroplast) [Hoplestigma klaineanum] Length = 672 Score = 80.5 bits (197), Expect = 2e-13 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = +1 Query: 214 AAHMPITKTSF*LGTLTLCGIPPLAYFWSNNEILSDNWLYSPIFA 348 A H+PITKTSF LGTL+LCGIPPLA FWS +EIL+D+WLYSPIFA Sbjct: 367 AKHVPITKTSFLLGTLSLCGIPPLACFWSKDEILNDSWLYSPIFA 411 >gb|AGV40988.1| NADH dehydrogenase subunit F, partial (chloroplast) [Rosa xanthina] Length = 651 Score = 80.5 bits (197), Expect = 2e-13 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = +1 Query: 220 HMPITKTSF*LGTLTLCGIPPLAYFWSNNEILSDNWLYSPIFA 348 H+PITKTSF LGTL+LCGIPPLA FWS +EILSD+WLYSPIFA Sbjct: 371 HVPITKTSFLLGTLSLCGIPPLACFWSKDEILSDSWLYSPIFA 413 >gb|AGH56002.1| NADH dehydrogenase subunit F, partial (chloroplast) [Cussonia thyrsiflora] Length = 628 Score = 80.5 bits (197), Expect = 2e-13 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = +1 Query: 220 HMPITKTSF*LGTLTLCGIPPLAYFWSNNEILSDNWLYSPIFA 348 HMPITKTSF LGTL+LCGIPPLA FWS +EIL+D WLYSPIFA Sbjct: 373 HMPITKTSFLLGTLSLCGIPPLACFWSKDEILNDTWLYSPIFA 415 >gb|AGH56001.1| NADH dehydrogenase subunit F, partial (chloroplast) [Cussonia spicata] Length = 628 Score = 80.5 bits (197), Expect = 2e-13 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = +1 Query: 220 HMPITKTSF*LGTLTLCGIPPLAYFWSNNEILSDNWLYSPIFA 348 HMPITKTSF LGTL+LCGIPPLA FWS +EIL+D WLYSPIFA Sbjct: 373 HMPITKTSFLLGTLSLCGIPPLACFWSKDEILNDTWLYSPIFA 415 >gb|AGH56000.1| NADH dehydrogenase subunit F, partial (chloroplast) [Cussonia paniculata] Length = 625 Score = 80.5 bits (197), Expect = 2e-13 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = +1 Query: 220 HMPITKTSF*LGTLTLCGIPPLAYFWSNNEILSDNWLYSPIFA 348 HMPITKTSF LGTL+LCGIPPLA FWS +EIL+D WLYSPIFA Sbjct: 373 HMPITKTSFLLGTLSLCGIPPLACFWSKDEILNDTWLYSPIFA 415 >gb|AFB83629.1| NADH dehydrogenase subunit F, partial (chloroplast) [Portulaca yecorensis] Length = 669 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = +1 Query: 220 HMPITKTSF*LGTLTLCGIPPLAYFWSNNEILSDNWLYSPIFAT 351 H+PITKT+F +GTL+LCGIPPLA FWS +EILSD+WLYSPIFAT Sbjct: 357 HVPITKTAFLIGTLSLCGIPPLACFWSKDEILSDSWLYSPIFAT 400 >gb|AFB83614.1| NADH dehydrogenase subunit F, partial (chloroplast) [Portulaca rotundifolia] Length = 670 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = +1 Query: 220 HMPITKTSF*LGTLTLCGIPPLAYFWSNNEILSDNWLYSPIFAT 351 H+PITKT+F +GTL+LCGIPPLA FWS +EILSD+WLYSPIFAT Sbjct: 357 HVPITKTAFLIGTLSLCGIPPLACFWSKDEILSDSWLYSPIFAT 400 >gb|AFB83613.1| NADH dehydrogenase subunit F, partial (chloroplast) [Portulaca retusa] Length = 652 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = +1 Query: 220 HMPITKTSF*LGTLTLCGIPPLAYFWSNNEILSDNWLYSPIFAT 351 H+PITKT+F +GTL+LCGIPPLA FWS +EILSD+WLYSPIFAT Sbjct: 341 HVPITKTAFLIGTLSLCGIPPLACFWSKDEILSDSWLYSPIFAT 384 >gb|AFB83601.1| NADH dehydrogenase subunit F, partial (chloroplast) [Portulaca oleracea subsp. oleracea] Length = 659 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = +1 Query: 220 HMPITKTSF*LGTLTLCGIPPLAYFWSNNEILSDNWLYSPIFAT 351 H+PITKT+F +GTL+LCGIPPLA FWS +EILSD+WLYSPIFAT Sbjct: 357 HVPITKTAFLIGTLSLCGIPPLACFWSKDEILSDSWLYSPIFAT 400 >gb|AFB83600.1| NADH dehydrogenase subunit F, partial (chloroplast) [Portulaca oleracea subsp. sativa] Length = 668 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = +1 Query: 220 HMPITKTSF*LGTLTLCGIPPLAYFWSNNEILSDNWLYSPIFAT 351 H+PITKT+F +GTL+LCGIPPLA FWS +EILSD+WLYSPIFAT Sbjct: 355 HVPITKTAFLIGTLSLCGIPPLACFWSKDEILSDSWLYSPIFAT 398 >gb|AFB83598.1| NADH dehydrogenase subunit F, partial (chloroplast) [Portulaca oleracea subsp. papillatostellulata] Length = 666 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = +1 Query: 220 HMPITKTSF*LGTLTLCGIPPLAYFWSNNEILSDNWLYSPIFAT 351 H+PITKT+F +GTL+LCGIPPLA FWS +EILSD+WLYSPIFAT Sbjct: 355 HVPITKTAFLIGTLSLCGIPPLACFWSKDEILSDSWLYSPIFAT 398 >gb|AFB83596.1| NADH dehydrogenase subunit F, partial (chloroplast) [Portulaca oleracea subsp. nitida] Length = 661 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = +1 Query: 220 HMPITKTSF*LGTLTLCGIPPLAYFWSNNEILSDNWLYSPIFAT 351 H+PITKT+F +GTL+LCGIPPLA FWS +EILSD+WLYSPIFAT Sbjct: 348 HVPITKTAFLIGTLSLCGIPPLACFWSKDEILSDSWLYSPIFAT 391 >gb|AFB83594.1| NADH dehydrogenase subunit F, partial (chloroplast) [Portulaca oleracea subsp. nicaraguensis] Length = 668 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = +1 Query: 220 HMPITKTSF*LGTLTLCGIPPLAYFWSNNEILSDNWLYSPIFAT 351 H+PITKT+F +GTL+LCGIPPLA FWS +EILSD+WLYSPIFAT Sbjct: 355 HVPITKTAFLIGTLSLCGIPPLACFWSKDEILSDSWLYSPIFAT 398 >gb|AFB83593.1| NADH dehydrogenase subunit F, partial (chloroplast) [Portulaca oleracea subsp. impolita] Length = 670 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = +1 Query: 220 HMPITKTSF*LGTLTLCGIPPLAYFWSNNEILSDNWLYSPIFAT 351 H+PITKT+F +GTL+LCGIPPLA FWS +EILSD+WLYSPIFAT Sbjct: 357 HVPITKTAFLIGTLSLCGIPPLACFWSKDEILSDSWLYSPIFAT 400 >gb|AFB83592.1| NADH dehydrogenase subunit F, partial (chloroplast) [Portulaca oleracea subsp. granulatostellulata] Length = 668 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = +1 Query: 220 HMPITKTSF*LGTLTLCGIPPLAYFWSNNEILSDNWLYSPIFAT 351 H+PITKT+F +GTL+LCGIPPLA FWS +EILSD+WLYSPIFAT Sbjct: 355 HVPITKTAFLIGTLSLCGIPPLACFWSKDEILSDSWLYSPIFAT 398 >gb|AFB83590.1| NADH dehydrogenase subunit F, partial (chloroplast) [Portulaca oleracea subsp. nitida] Length = 669 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = +1 Query: 220 HMPITKTSF*LGTLTLCGIPPLAYFWSNNEILSDNWLYSPIFAT 351 H+PITKT+F +GTL+LCGIPPLA FWS +EILSD+WLYSPIFAT Sbjct: 357 HVPITKTAFLIGTLSLCGIPPLACFWSKDEILSDSWLYSPIFAT 400