BLASTX nr result
ID: Paeonia22_contig00035364
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00035364 (405 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXJ68853.1| mitochondrial DNA replication protein YHM2 [Clado... 67 2e-09 gb|EPS34170.1| hypothetical protein PDE_09134 [Penicillium oxali... 66 6e-09 gb|EXJ60832.1| mitochondrial DNA replication protein YHM2 [Clado... 65 8e-09 gb|ETI24317.1| mitochondrial DNA replication protein YHM2 [Clado... 65 8e-09 gb|EKV12425.1| Mitochondrial DNA replication protein (Yhm2), put... 65 1e-08 ref|XP_003173603.1| mitochondrial DNA replication protein YHM2 [... 65 1e-08 gb|EXJ93860.1| mitochondrial DNA replication protein YHM2 [Capro... 64 2e-08 gb|ETN36365.1| mitochondrial DNA replication protein YHM2 [Cyphe... 64 2e-08 ref|XP_007582768.1| putative mitochondrial dna replication prote... 64 2e-08 gb|EHY54961.1| mitochondrial DNA replication protein YHM2 [Exoph... 64 2e-08 gb|EZF29575.1| mitochondrial DNA replication protein YHM2 [Trich... 64 3e-08 gb|EMD87368.1| hypothetical protein COCHEDRAFT_1023516 [Bipolari... 64 3e-08 gb|EKG11298.1| Mitochondrial substrate/solute carrier [Macrophom... 64 3e-08 gb|EGE03897.1| DNA binding protein [Trichophyton equinum CBS 127... 64 3e-08 gb|EGD92638.1| mitochondrial DNA replication protein [Trichophyt... 64 3e-08 ref|XP_003235070.1| mitochondrial DNA replication protein [Trich... 64 3e-08 ref|XP_003840475.1| hypothetical protein LEMA_P101270.1 [Leptosp... 64 3e-08 ref|XP_003021186.1| hypothetical protein TRV_04703 [Trichophyton... 64 3e-08 ref|XP_003014518.1| hypothetical protein ARB_07080 [Arthroderma ... 64 3e-08 ref|XP_002844875.1| mitochondrial DNA replication protein YHM2 [... 64 3e-08 >gb|EXJ68853.1| mitochondrial DNA replication protein YHM2 [Cladophialophora psammophila CBS 110553] Length = 316 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 LGVWQTICMVALGDIAKEAVEKLTGETVTAKH 96 LG+WQTICMVALGDIAKEAVEKLTGETVTAKH Sbjct: 285 LGIWQTICMVALGDIAKEAVEKLTGETVTAKH 316 >gb|EPS34170.1| hypothetical protein PDE_09134 [Penicillium oxalicum 114-2] Length = 314 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = +1 Query: 1 LGVWQTICMVALGDIAKEAVEKLTGETVTAKH 96 LG+WQT+CMVALGD+AKEAVEKLTGETVTAKH Sbjct: 283 LGIWQTVCMVALGDMAKEAVEKLTGETVTAKH 314 >gb|EXJ60832.1| mitochondrial DNA replication protein YHM2 [Cladophialophora yegresii CBS 114405] Length = 316 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +1 Query: 1 LGVWQTICMVALGDIAKEAVEKLTGETVTAKH 96 LGVWQTICMVALGDIAKEAVEKLTGE VTAKH Sbjct: 285 LGVWQTICMVALGDIAKEAVEKLTGEKVTAKH 316 >gb|ETI24317.1| mitochondrial DNA replication protein YHM2 [Cladophialophora carrionii CBS 160.54] Length = 316 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +1 Query: 1 LGVWQTICMVALGDIAKEAVEKLTGETVTAKH 96 LGVWQTICMVALGDIAKEAVEKLTGE VTAKH Sbjct: 285 LGVWQTICMVALGDIAKEAVEKLTGEKVTAKH 316 >gb|EKV12425.1| Mitochondrial DNA replication protein (Yhm2), putative [Penicillium digitatum PHI26] gi|425778561|gb|EKV16685.1| Mitochondrial DNA replication protein (Yhm2), putative [Penicillium digitatum Pd1] Length = 313 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = +1 Query: 1 LGVWQTICMVALGDIAKEAVEKLTGETVTAKH 96 LG+WQT+CMVALGD+AKEAVEKLTG+TVTAKH Sbjct: 282 LGIWQTVCMVALGDMAKEAVEKLTGDTVTAKH 313 >ref|XP_003173603.1| mitochondrial DNA replication protein YHM2 [Arthroderma gypseum CBS 118893] gi|311341570|gb|EFR00773.1| mitochondrial DNA replication protein YHM2 [Arthroderma gypseum CBS 118893] Length = 308 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = +1 Query: 1 LGVWQTICMVALGDIAKEAVEKLTGETVTAKH 96 LG+WQT+CMVALGD+AKEAVEKLTG+TVTAKH Sbjct: 277 LGIWQTVCMVALGDMAKEAVEKLTGDTVTAKH 308 >gb|EXJ93860.1| mitochondrial DNA replication protein YHM2 [Capronia coronata CBS 617.96] Length = 317 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 1 LGVWQTICMVALGDIAKEAVEKLTGETVTAKH 96 LGVWQTICMVALGD+AKEAVEKLTGE VTAKH Sbjct: 286 LGVWQTICMVALGDMAKEAVEKLTGEKVTAKH 317 >gb|ETN36365.1| mitochondrial DNA replication protein YHM2 [Cyphellophora europaea CBS 101466] Length = 317 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +1 Query: 1 LGVWQTICMVALGDIAKEAVEKLTGETVTAKH 96 LGVWQT+CMVALGD+AKEAVEKLTGE VTAKH Sbjct: 286 LGVWQTVCMVALGDMAKEAVEKLTGEAVTAKH 317 >ref|XP_007582768.1| putative mitochondrial dna replication protein [Neofusicoccum parvum UCRNP2] gi|485925108|gb|EOD49757.1| putative mitochondrial dna replication protein [Neofusicoccum parvum UCRNP2] Length = 310 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = +1 Query: 1 LGVWQTICMVALGDIAKEAVEKLTGETVTAKH 96 LGVWQT+CMVALGD+AKEAVEKLTG++VTAKH Sbjct: 279 LGVWQTVCMVALGDVAKEAVEKLTGDSVTAKH 310 >gb|EHY54961.1| mitochondrial DNA replication protein YHM2 [Exophiala dermatitidis NIH/UT8656] Length = 317 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +1 Query: 1 LGVWQTICMVALGDIAKEAVEKLTGETVTAKH 96 LG+WQTICMVALGD+AKEAVEKLTGE VTAKH Sbjct: 286 LGIWQTICMVALGDMAKEAVEKLTGEKVTAKH 317 >gb|EZF29575.1| mitochondrial DNA replication protein YHM2 [Trichophyton interdigitale H6] Length = 266 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 1 LGVWQTICMVALGDIAKEAVEKLTGETVTAKH 96 LG+WQT+CMVALGD+AKEAVEKLTGE VTAKH Sbjct: 235 LGIWQTVCMVALGDMAKEAVEKLTGEKVTAKH 266 >gb|EMD87368.1| hypothetical protein COCHEDRAFT_1023516 [Bipolaris maydis C5] gi|477589490|gb|ENI06566.1| hypothetical protein COCC4DRAFT_31321 [Bipolaris maydis ATCC 48331] Length = 319 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 1 LGVWQTICMVALGDIAKEAVEKLTGETVTAKH 96 LGVWQT+CMVALGD+AKEAVEKLTG+ VTAKH Sbjct: 288 LGVWQTVCMVALGDVAKEAVEKLTGDKVTAKH 319 >gb|EKG11298.1| Mitochondrial substrate/solute carrier [Macrophomina phaseolina MS6] Length = 310 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 1 LGVWQTICMVALGDIAKEAVEKLTGETVTAKH 96 LGVWQT+CMVALGD+AKEAVEKLTG+ VTAKH Sbjct: 279 LGVWQTVCMVALGDVAKEAVEKLTGDKVTAKH 310 >gb|EGE03897.1| DNA binding protein [Trichophyton equinum CBS 127.97] Length = 309 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 1 LGVWQTICMVALGDIAKEAVEKLTGETVTAKH 96 LG+WQT+CMVALGD+AKEAVEKLTGE VTAKH Sbjct: 278 LGIWQTVCMVALGDMAKEAVEKLTGEKVTAKH 309 >gb|EGD92638.1| mitochondrial DNA replication protein [Trichophyton tonsurans CBS 112818] Length = 309 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 1 LGVWQTICMVALGDIAKEAVEKLTGETVTAKH 96 LG+WQT+CMVALGD+AKEAVEKLTGE VTAKH Sbjct: 278 LGIWQTVCMVALGDMAKEAVEKLTGEKVTAKH 309 >ref|XP_003235070.1| mitochondrial DNA replication protein [Trichophyton rubrum CBS 118892] gi|326462422|gb|EGD87875.1| mitochondrial DNA replication protein [Trichophyton rubrum CBS 118892] gi|607877741|gb|EZF22854.1| mitochondrial DNA replication protein YHM2 [Trichophyton rubrum MR850] gi|607904553|gb|EZF41958.1| mitochondrial DNA replication protein YHM2 [Trichophyton rubrum CBS 100081] gi|607916656|gb|EZF52614.1| mitochondrial DNA replication protein YHM2 [Trichophyton rubrum CBS 288.86] gi|607928800|gb|EZF63311.1| mitochondrial DNA replication protein YHM2 [Trichophyton rubrum CBS 289.86] gi|607940625|gb|EZF73847.1| mitochondrial DNA replication protein YHM2 [Trichophyton soudanense CBS 452.61] gi|607952702|gb|EZF84527.1| mitochondrial DNA replication protein YHM2 [Trichophyton rubrum MR1448] gi|607964959|gb|EZF95330.1| mitochondrial DNA replication protein YHM2 [Trichophyton rubrum MR1459] gi|607977239|gb|EZG06403.1| mitochondrial DNA replication protein YHM2 [Trichophyton rubrum CBS 735.88] gi|607988929|gb|EZG16879.1| mitochondrial DNA replication protein YHM2 [Trichophyton rubrum CBS 202.88] Length = 309 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 1 LGVWQTICMVALGDIAKEAVEKLTGETVTAKH 96 LG+WQT+CMVALGD+AKEAVEKLTGE VTAKH Sbjct: 278 LGIWQTVCMVALGDMAKEAVEKLTGEKVTAKH 309 >ref|XP_003840475.1| hypothetical protein LEMA_P101270.1 [Leptosphaeria maculans JN3] gi|312217047|emb|CBX96996.1| hypothetical protein LEMA_P101270.1 [Leptosphaeria maculans JN3] Length = 398 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 1 LGVWQTICMVALGDIAKEAVEKLTGETVTAKH 96 LGVWQT+CMVALGD+AKEAVEKLTG+ VTAKH Sbjct: 367 LGVWQTVCMVALGDVAKEAVEKLTGDKVTAKH 398 >ref|XP_003021186.1| hypothetical protein TRV_04703 [Trichophyton verrucosum HKI 0517] gi|291185073|gb|EFE40568.1| hypothetical protein TRV_04703 [Trichophyton verrucosum HKI 0517] Length = 320 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 1 LGVWQTICMVALGDIAKEAVEKLTGETVTAKH 96 LG+WQT+CMVALGD+AKEAVEKLTGE VTAKH Sbjct: 289 LGIWQTVCMVALGDMAKEAVEKLTGEKVTAKH 320 >ref|XP_003014518.1| hypothetical protein ARB_07080 [Arthroderma benhamiae CBS 112371] gi|291178339|gb|EFE34129.1| hypothetical protein ARB_07080 [Arthroderma benhamiae CBS 112371] Length = 320 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 1 LGVWQTICMVALGDIAKEAVEKLTGETVTAKH 96 LG+WQT+CMVALGD+AKEAVEKLTGE VTAKH Sbjct: 289 LGIWQTVCMVALGDMAKEAVEKLTGEKVTAKH 320 >ref|XP_002844875.1| mitochondrial DNA replication protein YHM2 [Arthroderma otae CBS 113480] gi|238844358|gb|EEQ34020.1| mitochondrial DNA replication protein YHM2 [Arthroderma otae CBS 113480] Length = 308 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 1 LGVWQTICMVALGDIAKEAVEKLTGETVTAKH 96 LG+WQT+CMVALGD+AKEAVEKLTGE VTAKH Sbjct: 277 LGIWQTVCMVALGDMAKEAVEKLTGEKVTAKH 308