BLASTX nr result
ID: Paeonia22_contig00035087
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00035087 (488 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631455.1| PREDICTED: pentatricopeptide repeat-containi... 85 9e-15 emb|CBI25851.3| unnamed protein product [Vitis vinifera] 85 9e-15 emb|CAN68810.1| hypothetical protein VITISV_001082 [Vitis vinifera] 85 9e-15 ref|XP_002531466.1| pentatricopeptide repeat-containing protein,... 79 5e-13 ref|XP_006477135.1| PREDICTED: pentatricopeptide repeat-containi... 77 2e-12 ref|XP_006440247.1| hypothetical protein CICLE_v10019985mg [Citr... 77 2e-12 ref|XP_004139002.1| PREDICTED: pentatricopeptide repeat-containi... 74 3e-11 ref|XP_007039757.1| Tetratricopeptide repeat-like superfamily pr... 72 8e-11 gb|EXC02094.1| hypothetical protein L484_024059 [Morus notabilis] 67 2e-09 ref|XP_006282107.1| hypothetical protein CARUB_v10028355mg, part... 63 4e-08 ref|XP_007131288.1| hypothetical protein PHAVU_011G001300g [Phas... 60 4e-07 ref|XP_004515635.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 gb|EPS63367.1| hypothetical protein M569_11418 [Genlisea aurea] 59 5e-07 ref|XP_006398426.1| hypothetical protein EUTSA_v10000870mg [Eutr... 59 9e-07 ref|XP_004245793.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|NP_199547.1| pentatricopeptide repeat-containing protein [Ar... 57 3e-06 ref|XP_003604902.1| Pentatricopeptide repeat-containing protein ... 57 3e-06 ref|XP_006368989.1| hypothetical protein POPTR_0001s15470g [Popu... 56 5e-06 ref|XP_006359252.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 ref|XP_006359251.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 >ref|XP_003631455.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like [Vitis vinifera] Length = 638 Score = 85.1 bits (209), Expect = 9e-15 Identities = 41/53 (77%), Positives = 43/53 (81%) Frame = -3 Query: 159 SSKYITHLQKNGRNIEKTLSTVRAKLDSSCVNEVLGSCSLNQSLLGLRFFVWA 1 + KY THLQK G NIEKTL VRAKLDSSCVNEVL CSL QS LGLRFF+WA Sbjct: 28 AEKYYTHLQKYGDNIEKTLPAVRAKLDSSCVNEVLNRCSLTQSQLGLRFFIWA 80 >emb|CBI25851.3| unnamed protein product [Vitis vinifera] Length = 528 Score = 85.1 bits (209), Expect = 9e-15 Identities = 41/53 (77%), Positives = 43/53 (81%) Frame = -3 Query: 159 SSKYITHLQKNGRNIEKTLSTVRAKLDSSCVNEVLGSCSLNQSLLGLRFFVWA 1 + KY THLQK G NIEKTL VRAKLDSSCVNEVL CSL QS LGLRFF+WA Sbjct: 34 AEKYYTHLQKYGDNIEKTLPAVRAKLDSSCVNEVLNRCSLTQSQLGLRFFIWA 86 >emb|CAN68810.1| hypothetical protein VITISV_001082 [Vitis vinifera] Length = 577 Score = 85.1 bits (209), Expect = 9e-15 Identities = 41/53 (77%), Positives = 43/53 (81%) Frame = -3 Query: 159 SSKYITHLQKNGRNIEKTLSTVRAKLDSSCVNEVLGSCSLNQSLLGLRFFVWA 1 + KY THLQK G NIEKTL VRAKLDSSCVNEVL CSL QS LGLRFF+WA Sbjct: 28 AEKYYTHLQKYGDNIEKTLPAVRAKLDSSCVNEVLNRCSLTQSQLGLRFFIWA 80 >ref|XP_002531466.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528920|gb|EEF30916.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 518 Score = 79.3 bits (194), Expect = 5e-13 Identities = 39/67 (58%), Positives = 49/67 (73%), Gaps = 1/67 (1%) Frame = -3 Query: 198 KISTNSTLQFTT-VSSKYITHLQKNGRNIEKTLSTVRAKLDSSCVNEVLGSCSLNQSLLG 22 K S STL FTT ++ K THLQ N N+EK+L++++ KLD+ CV EVL CSLN S +G Sbjct: 17 KTSKISTLHFTTSLADKLYTHLQNNPNNVEKSLNSIKPKLDTRCVTEVLHKCSLNNSQIG 76 Query: 21 LRFFVWA 1 LRFFVWA Sbjct: 77 LRFFVWA 83 >ref|XP_006477135.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like isoform X1 [Citrus sinensis] gi|568846596|ref|XP_006477136.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like isoform X2 [Citrus sinensis] gi|568846598|ref|XP_006477137.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like isoform X3 [Citrus sinensis] Length = 475 Score = 77.0 bits (188), Expect = 2e-12 Identities = 38/61 (62%), Positives = 47/61 (77%), Gaps = 2/61 (3%) Frame = -3 Query: 177 LQFTTVS--SKYITHLQKNGRNIEKTLSTVRAKLDSSCVNEVLGSCSLNQSLLGLRFFVW 4 L FTT S ++ THLQKN NIEKTL+TV+AKLDS+CV EVL C +QS +G+RFF+W Sbjct: 24 LHFTTASPAERFYTHLQKNPNNIEKTLATVKAKLDSTCVIEVLHRCFPSQSQMGIRFFIW 83 Query: 3 A 1 A Sbjct: 84 A 84 >ref|XP_006440247.1| hypothetical protein CICLE_v10019985mg [Citrus clementina] gi|567895520|ref|XP_006440248.1| hypothetical protein CICLE_v10019985mg [Citrus clementina] gi|567895522|ref|XP_006440249.1| hypothetical protein CICLE_v10019985mg [Citrus clementina] gi|557542509|gb|ESR53487.1| hypothetical protein CICLE_v10019985mg [Citrus clementina] gi|557542510|gb|ESR53488.1| hypothetical protein CICLE_v10019985mg [Citrus clementina] gi|557542511|gb|ESR53489.1| hypothetical protein CICLE_v10019985mg [Citrus clementina] Length = 475 Score = 77.0 bits (188), Expect = 2e-12 Identities = 38/61 (62%), Positives = 47/61 (77%), Gaps = 2/61 (3%) Frame = -3 Query: 177 LQFTTVS--SKYITHLQKNGRNIEKTLSTVRAKLDSSCVNEVLGSCSLNQSLLGLRFFVW 4 L FTT S ++ THLQKN NIEKTL+TV+AKLDS+CV EVL C +QS +G+RFF+W Sbjct: 24 LHFTTASPAERFYTHLQKNPNNIEKTLATVKAKLDSTCVIEVLHRCFPSQSQMGIRFFIW 83 Query: 3 A 1 A Sbjct: 84 A 84 >ref|XP_004139002.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like [Cucumis sativus] gi|449505643|ref|XP_004162530.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like [Cucumis sativus] Length = 475 Score = 73.6 bits (179), Expect = 3e-11 Identities = 36/67 (53%), Positives = 47/67 (70%), Gaps = 2/67 (2%) Frame = -3 Query: 195 ISTNSTLQFTTVSSK--YITHLQKNGRNIEKTLSTVRAKLDSSCVNEVLGSCSLNQSLLG 22 IST ST T+SS + HL+K+ N++KTL+T++ KLDS CVNEVL CS S +G Sbjct: 18 ISTLSTFHLNTLSSSDLFYDHLEKSNGNLDKTLATLKTKLDSRCVNEVLYKCSFELSQMG 77 Query: 21 LRFFVWA 1 LRFF+WA Sbjct: 78 LRFFIWA 84 >ref|XP_007039757.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|590676515|ref|XP_007039758.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|590676519|ref|XP_007039759.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|590676523|ref|XP_007039760.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508777002|gb|EOY24258.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508777003|gb|EOY24259.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508777004|gb|EOY24260.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508777005|gb|EOY24261.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] Length = 483 Score = 72.0 bits (175), Expect = 8e-11 Identities = 36/62 (58%), Positives = 45/62 (72%), Gaps = 2/62 (3%) Frame = -3 Query: 180 TLQFTTVSS--KYITHLQKNGRNIEKTLSTVRAKLDSSCVNEVLGSCSLNQSLLGLRFFV 7 T F+T SS K+ THLQK NIEKTL+ V +KLDS+CV EVL C ++S +GLRFF+ Sbjct: 23 TFLFSTASSADKFFTHLQKKQSNIEKTLALVNSKLDSNCVCEVLERCCFDKSQMGLRFFI 82 Query: 6 WA 1 WA Sbjct: 83 WA 84 >gb|EXC02094.1| hypothetical protein L484_024059 [Morus notabilis] Length = 474 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/63 (52%), Positives = 44/63 (69%), Gaps = 2/63 (3%) Frame = -3 Query: 183 STLQFTTVSS--KYITHLQKNGRNIEKTLSTVRAKLDSSCVNEVLGSCSLNQSLLGLRFF 10 ST++F SS K HL KNG NIEKTL+T++ KLD V++VL C +QS +G+RFF Sbjct: 22 STIRFAITSSADKIFDHLNKNGGNIEKTLATIKPKLDPKFVSDVLFKCHPSQSQMGIRFF 81 Query: 9 VWA 1 +WA Sbjct: 82 IWA 84 >ref|XP_006282107.1| hypothetical protein CARUB_v10028355mg, partial [Capsella rubella] gi|482550811|gb|EOA15005.1| hypothetical protein CARUB_v10028355mg, partial [Capsella rubella] Length = 493 Score = 63.2 bits (152), Expect = 4e-08 Identities = 32/64 (50%), Positives = 42/64 (65%), Gaps = 3/64 (4%) Frame = -3 Query: 183 STLQFTTVSS---KYITHLQKNGRNIEKTLSTVRAKLDSSCVNEVLGSCSLNQSLLGLRF 13 S LQF+T S + HLQ N+EK L++ + KL+SSC+NEV+ C NQ LGLRF Sbjct: 38 SALQFSTTISAAERLYDHLQGCTTNLEKELASAKVKLESSCINEVIRRCHPNQFQLGLRF 97 Query: 12 FVWA 1 F+WA Sbjct: 98 FIWA 101 >ref|XP_007131288.1| hypothetical protein PHAVU_011G001300g [Phaseolus vulgaris] gi|561004288|gb|ESW03282.1| hypothetical protein PHAVU_011G001300g [Phaseolus vulgaris] Length = 474 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 4/64 (6%) Frame = -3 Query: 180 TLQFTT----VSSKYITHLQKNGRNIEKTLSTVRAKLDSSCVNEVLGSCSLNQSLLGLRF 13 TL F+T ++ THL ++ +E +LS V+ KLDS CV +VL SC Q LLG+RF Sbjct: 18 TLPFSTHRMGMADTLCTHLHQSNGGVENSLSKVKPKLDSRCVIQVLNSCHPKQLLLGVRF 77 Query: 12 FVWA 1 FVWA Sbjct: 78 FVWA 81 >ref|XP_004515635.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like [Cicer arietinum] Length = 477 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/58 (50%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = -3 Query: 171 FTTVSSKYITHL-QKNGRNIEKTLSTVRAKLDSSCVNEVLGSCSLNQSLLGLRFFVWA 1 F +++ THL + NG NIE +LS + KLDS CV +VL C QS LG+RFF+WA Sbjct: 28 FASIADTLYTHLHENNGINIENSLSKKKPKLDSQCVIQVLSKCCPKQSQLGVRFFIWA 85 >gb|EPS63367.1| hypothetical protein M569_11418 [Genlisea aurea] Length = 484 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/50 (50%), Positives = 38/50 (76%) Frame = -3 Query: 150 YITHLQKNGRNIEKTLSTVRAKLDSSCVNEVLGSCSLNQSLLGLRFFVWA 1 +I L K+ N+EKTL +V+AKLD+ C+ +VL +C+ ++S L LRFF+WA Sbjct: 41 FIAQLLKDPNNVEKTLDSVKAKLDARCITQVLATCARSKSQLCLRFFIWA 90 >ref|XP_006398426.1| hypothetical protein EUTSA_v10000870mg [Eutrema salsugineum] gi|557099515|gb|ESQ39879.1| hypothetical protein EUTSA_v10000870mg [Eutrema salsugineum] Length = 478 Score = 58.5 bits (140), Expect = 9e-07 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 3/64 (4%) Frame = -3 Query: 183 STLQFTTVSS---KYITHLQKNGRNIEKTLSTVRAKLDSSCVNEVLGSCSLNQSLLGLRF 13 S L+F+T S + HLQ N EK L++ + KLD+S +NEV+ CS NQ LGLRF Sbjct: 22 SALRFSTTVSAAERLYDHLQGCKNNPEKELASAKVKLDASTINEVIKRCSPNQFQLGLRF 81 Query: 12 FVWA 1 F+WA Sbjct: 82 FIWA 85 >ref|XP_004245793.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like [Solanum lycopersicum] Length = 480 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/55 (47%), Positives = 41/55 (74%), Gaps = 2/55 (3%) Frame = -3 Query: 159 SSKYITHLQKNGR--NIEKTLSTVRAKLDSSCVNEVLGSCSLNQSLLGLRFFVWA 1 + +Y++HL KN +E+TLS+VR+KLD+ CV+EVL C+++ + LRFF+WA Sbjct: 40 AGEYLSHLLKNKNVSGMERTLSSVRSKLDARCVDEVLEKCAVDDPQMCLRFFIWA 94 >ref|NP_199547.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75180684|sp|Q9LVS3.1|PP422_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g47360 gi|8809619|dbj|BAA97170.1| unnamed protein product [Arabidopsis thaliana] gi|332008119|gb|AED95502.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 477 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/66 (43%), Positives = 38/66 (57%) Frame = -3 Query: 198 KISTNSTLQFTTVSSKYITHLQKNGRNIEKTLSTVRAKLDSSCVNEVLGSCSLNQSLLGL 19 KIS L + + + LQ N+EK L++ +LDSSC+NEVL C NQ GL Sbjct: 20 KISALRFLTTVSAAERLYGQLQGCTSNLEKELASANVQLDSSCINEVLRRCDPNQFQSGL 79 Query: 18 RFFVWA 1 RFF+WA Sbjct: 80 RFFIWA 85 >ref|XP_003604902.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355505957|gb|AES87099.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 449 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/57 (49%), Positives = 36/57 (63%), Gaps = 1/57 (1%) Frame = -3 Query: 168 TTVSSKYITHLQK-NGRNIEKTLSTVRAKLDSSCVNEVLGSCSLNQSLLGLRFFVWA 1 ++++ THL K NG IE LS + KLDS CV +VL C QS LG+RFF+WA Sbjct: 4 SSIADTLYTHLNKTNGITIENALSKTKPKLDSQCVIQVLNKCFPKQSQLGVRFFIWA 60 >ref|XP_006368989.1| hypothetical protein POPTR_0001s15470g [Populus trichocarpa] gi|550347348|gb|ERP65558.1| hypothetical protein POPTR_0001s15470g [Populus trichocarpa] Length = 476 Score = 56.2 bits (134), Expect = 5e-06 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 3/64 (4%) Frame = -3 Query: 183 STLQFTTVS--SKYITHLQKNGRNIEKTLSTVRA-KLDSSCVNEVLGSCSLNQSLLGLRF 13 STL F T S K HLQ + N+EKTL+++ KLD+ VN+++ SLN LGLRF Sbjct: 22 STLHFATTSLGEKLDAHLQNSPNNVEKTLNSLAPIKLDTKYVNDIIHRWSLNNLQLGLRF 81 Query: 12 FVWA 1 F+WA Sbjct: 82 FIWA 85 >ref|XP_006359252.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like isoform X2 [Solanum tuberosum] Length = 487 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/55 (45%), Positives = 41/55 (74%), Gaps = 2/55 (3%) Frame = -3 Query: 159 SSKYITHL--QKNGRNIEKTLSTVRAKLDSSCVNEVLGSCSLNQSLLGLRFFVWA 1 + ++++HL KN +E+TLS+VR+KLD+ CV+EVL C+++ + LRFF+WA Sbjct: 36 AGEFLSHLLNNKNVSGMERTLSSVRSKLDARCVDEVLEKCAVDDPQMCLRFFIWA 90 >ref|XP_006359251.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like isoform X1 [Solanum tuberosum] Length = 488 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/55 (45%), Positives = 41/55 (74%), Gaps = 2/55 (3%) Frame = -3 Query: 159 SSKYITHL--QKNGRNIEKTLSTVRAKLDSSCVNEVLGSCSLNQSLLGLRFFVWA 1 + ++++HL KN +E+TLS+VR+KLD+ CV+EVL C+++ + LRFF+WA Sbjct: 36 AGEFLSHLLNNKNVSGMERTLSSVRSKLDARCVDEVLEKCAVDDPQMCLRFFIWA 90