BLASTX nr result
ID: Paeonia22_contig00034938
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00034938 (286 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGC78906.1| hypothetical protein (mitochondrion) [Vicia faba]... 132 5e-33 gb|AGC78907.1| hypothetical protein (mitochondrion) [Vicia faba]... 50 3e-10 gb|ABA97927.1| hypothetical protein LOC_Os12g23620 [Oryza sativa... 43 7e-06 >gb|AGC78906.1| hypothetical protein (mitochondrion) [Vicia faba] gi|442803202|gb|AGC78937.1| hypothetical protein (mitochondrion) [Vicia faba] gi|442803285|gb|AGC79020.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 111 Score = 132 bits (331), Expect(2) = 5e-33 Identities = 68/80 (85%), Positives = 70/80 (87%) Frame = -1 Query: 241 PLLNKGKKASTRTTFLLRADVAKCLTLLVIVSCCCGRCSFARA*TNPTNKKERMPLGASE 62 P NKG KASTRTTFLLRAD+AKCLTLLVIV CCCG+CSFAR NPTN KERMPLGASE Sbjct: 28 PKTNKGNKASTRTTFLLRADLAKCLTLLVIVPCCCGQCSFAR---NPTN-KERMPLGASE 83 Query: 61 NDSSRMKGNSHVQFVFFFWG 2 NDSSRMKGNSHVQFVFF G Sbjct: 84 NDSSRMKGNSHVQFVFFGGG 103 Score = 35.0 bits (79), Expect(2) = 5e-33 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = -3 Query: 284 VVVRKARTPRTSRAPFTK*GKES 216 VVVRKARTPRTSRAP T G ++ Sbjct: 14 VVVRKARTPRTSRAPKTNKGNKA 36 >gb|AGC78907.1| hypothetical protein (mitochondrion) [Vicia faba] gi|442803201|gb|AGC78936.1| hypothetical protein (mitochondrion) [Vicia faba] gi|442803286|gb|AGC79021.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 116 Score = 50.1 bits (118), Expect(2) = 3e-10 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = +3 Query: 153 MTNRVRHLATSARKRNVVLVEAFFPLFSKG 242 MTNRVRHLA SARKRNVVLVEA FPL G Sbjct: 1 MTNRVRHLAKSARKRNVVLVEALFPLLVLG 30 Score = 40.4 bits (93), Expect(2) = 3e-10 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = +1 Query: 223 FPYLVKGARDVRGVRAFRTTT 285 FP LV GARDVRGVRAFRTTT Sbjct: 24 FPLLVLGARDVRGVRAFRTTT 44 >gb|ABA97927.1| hypothetical protein LOC_Os12g23620 [Oryza sativa Japonica Group] Length = 111 Score = 42.7 bits (99), Expect(2) = 7e-06 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = -3 Query: 173 VSDSIGHSFLLLRPVLVCARVNQPNKQ 93 VSDSIGHS LLLRPVLVCARV +K+ Sbjct: 77 VSDSIGHSSLLLRPVLVCARVTAIHKR 103 Score = 32.7 bits (73), Expect(2) = 7e-06 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 285 CGGTEGTDSANVPRPL 238 CGG EGTDSA+VP PL Sbjct: 46 CGGMEGTDSASVPHPL 61