BLASTX nr result
ID: Paeonia22_contig00034492
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00034492 (462 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007038505.1| Cytochrome P450 704C1 [Theobroma cacao] gi|5... 56 6e-06 ref|XP_007038501.1| Cytochrome P450, putative isoform 1 [Theobro... 56 6e-06 >ref|XP_007038505.1| Cytochrome P450 704C1 [Theobroma cacao] gi|508775750|gb|EOY23006.1| Cytochrome P450 704C1 [Theobroma cacao] Length = 768 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -3 Query: 136 ID*IFRVGYDIELNFLSGSNEQGNQFTKDFDDSNVSVF 23 +D IF+VG+ +ELN LSGS+E GNQFTK FDDSNV V+ Sbjct: 442 LDSIFKVGFGVELNALSGSDEFGNQFTKAFDDSNVIVY 479 >ref|XP_007038501.1| Cytochrome P450, putative isoform 1 [Theobroma cacao] gi|590672057|ref|XP_007038502.1| Cytochrome P450, putative isoform 1 [Theobroma cacao] gi|508775746|gb|EOY23002.1| Cytochrome P450, putative isoform 1 [Theobroma cacao] gi|508775747|gb|EOY23003.1| Cytochrome P450, putative isoform 1 [Theobroma cacao] Length = 326 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -3 Query: 136 ID*IFRVGYDIELNFLSGSNEQGNQFTKDFDDSNVSVF 23 +D IF+VG+ +ELN LSGS+E GNQFTK FDDSNV V+ Sbjct: 135 LDSIFKVGFGVELNALSGSDEFGNQFTKAFDDSNVIVY 172