BLASTX nr result
ID: Paeonia22_contig00034313
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00034313 (291 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007010130.1| Cysteine/Histidine-rich C1 domain family pro... 64 2e-08 gb|EXB57305.1| hypothetical protein L484_011392 [Morus notabilis] 64 3e-08 gb|EXB57302.1| hypothetical protein L484_011389 [Morus notabilis] 64 3e-08 ref|XP_007030358.1| Uncharacterized protein TCM_026154 [Theobrom... 63 4e-08 gb|EXB57306.1| hypothetical protein L484_011393 [Morus notabilis] 62 8e-08 ref|XP_007011171.1| Cysteine/Histidine-rich C1 domain family pro... 60 4e-07 ref|XP_007030354.1| Uncharacterized protein TCM_026150 [Theobrom... 60 4e-07 ref|XP_007023008.1| Cysteine/Histidine-rich C1 domain family pro... 59 7e-07 ref|XP_007023007.1| Cysteine/Histidine-rich C1 domain family pro... 59 7e-07 ref|XP_007023006.1| Cysteine/Histidine-rich C1 domain family pro... 59 7e-07 ref|XP_007030357.1| Cysteine/Histidine-rich C1 domain family pro... 59 7e-07 ref|XP_007023024.1| Cysteine/Histidine-rich C1 domain family pro... 59 9e-07 ref|XP_007023019.1| Cysteine/Histidine-rich C1 domain family pro... 58 2e-06 ref|XP_007023010.1| Cysteine/Histidine-rich C1 domain family pro... 57 3e-06 ref|XP_007030367.1| Cysteine/Histidine-rich C1 domain family pro... 56 5e-06 ref|XP_006464498.1| PREDICTED: uncharacterized protein LOC102623... 56 6e-06 ref|XP_006427961.1| hypothetical protein CICLE_v10027263mg, part... 56 6e-06 gb|EXB50271.1| hypothetical protein L484_017808 [Morus notabilis] 55 8e-06 ref|XP_007023017.1| Cysteine/Histidine-rich C1 domain family pro... 55 8e-06 >ref|XP_007010130.1| Cysteine/Histidine-rich C1 domain family protein [Theobroma cacao] gi|508727043|gb|EOY18940.1| Cysteine/Histidine-rich C1 domain family protein [Theobroma cacao] Length = 445 Score = 63.9 bits (154), Expect = 2e-08 Identities = 22/35 (62%), Positives = 29/35 (82%) Frame = -1 Query: 291 FYCDACETERNPRHAVYYCEECEFIAHVRCVISEV 187 +YCD CE +RNP H+VY+CEEC +I H+ CV+SEV Sbjct: 325 YYCDVCEAKRNPNHSVYFCEECNYITHIHCVMSEV 359 >gb|EXB57305.1| hypothetical protein L484_011392 [Morus notabilis] Length = 679 Score = 63.5 bits (153), Expect = 3e-08 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -1 Query: 291 FYCDACETERNPRHAVYYCEECEFIAHVRCVISEV 187 +YCD CETER+PR +YYCEEC+F AHV CV+SE+ Sbjct: 332 YYCDVCETERDPRIRLYYCEECKFFAHVHCVMSEM 366 >gb|EXB57302.1| hypothetical protein L484_011389 [Morus notabilis] Length = 679 Score = 63.5 bits (153), Expect = 3e-08 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -1 Query: 291 FYCDACETERNPRHAVYYCEECEFIAHVRCVISEV 187 +YCD CETER+PR +YYCEEC+F AHV CV+SE+ Sbjct: 332 YYCDVCETERDPRIRLYYCEECKFFAHVHCVMSEM 366 >ref|XP_007030358.1| Uncharacterized protein TCM_026154 [Theobroma cacao] gi|508718963|gb|EOY10860.1| Uncharacterized protein TCM_026154 [Theobroma cacao] Length = 898 Score = 63.2 bits (152), Expect = 4e-08 Identities = 22/40 (55%), Positives = 30/40 (75%) Frame = -1 Query: 291 FYCDACETERNPRHAVYYCEECEFIAHVRCVISEVCSNSV 172 +YCD CE ERNP+H +YYC++C +I HV CV+ EV + V Sbjct: 342 YYCDICEEERNPKHHIYYCKKCTYIGHVECVVKEVSDSEV 381 >gb|EXB57306.1| hypothetical protein L484_011393 [Morus notabilis] Length = 662 Score = 62.0 bits (149), Expect = 8e-08 Identities = 23/41 (56%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -1 Query: 291 FYCDACETERNPRHAVYYCEECEFIAHVRCVISEV-CSNSV 172 +YCD CE+ER+PR +YYC+EC+F AHV C+ISE+ C + + Sbjct: 327 YYCDVCESERDPRIRIYYCQECKFFAHVHCLISELQCDDQI 367 >ref|XP_007011171.1| Cysteine/Histidine-rich C1 domain family protein [Theobroma cacao] gi|508728084|gb|EOY19981.1| Cysteine/Histidine-rich C1 domain family protein [Theobroma cacao] Length = 402 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 7/55 (12%) Frame = -1 Query: 291 FYCDACETERNPRHAVYYCEECEFIAHVRCVISEVCSNSV-----FHCF--QKGR 148 +YCD C+ ERNP H VY CE+C++I HV CV++EV + F CF QKG+ Sbjct: 332 YYCDICKNERNPAHPVYCCEKCKYITHVHCVLNEVKITCLTFFLFFLCFENQKGK 386 >ref|XP_007030354.1| Uncharacterized protein TCM_026150 [Theobroma cacao] gi|508718959|gb|EOY10856.1| Uncharacterized protein TCM_026150 [Theobroma cacao] Length = 236 Score = 59.7 bits (143), Expect = 4e-07 Identities = 20/32 (62%), Positives = 27/32 (84%) Frame = -1 Query: 291 FYCDACETERNPRHAVYYCEECEFIAHVRCVI 196 +YCD CE +RNP H VYYCE+C +IAH++CV+ Sbjct: 55 YYCDICEEKRNPEHHVYYCEQCTYIAHIKCVL 86 >ref|XP_007023008.1| Cysteine/Histidine-rich C1 domain family protein isoform 3 [Theobroma cacao] gi|508778374|gb|EOY25630.1| Cysteine/Histidine-rich C1 domain family protein isoform 3 [Theobroma cacao] Length = 937 Score = 58.9 bits (141), Expect = 7e-07 Identities = 21/50 (42%), Positives = 32/50 (64%) Frame = -1 Query: 291 FYCDACETERNPRHAVYYCEECEFIAHVRCVISEVCSNSVFHCFQKGRLN 142 +YCD CE ER P+H+VY C++C+FIAH+ C + +V + C L+ Sbjct: 322 YYCDICEEERKPKHSVYCCKKCKFIAHIECALKKVVDIKLDQCLTSSLLD 371 >ref|XP_007023007.1| Cysteine/Histidine-rich C1 domain family protein isoform 2 [Theobroma cacao] gi|508778373|gb|EOY25629.1| Cysteine/Histidine-rich C1 domain family protein isoform 2 [Theobroma cacao] Length = 749 Score = 58.9 bits (141), Expect = 7e-07 Identities = 21/50 (42%), Positives = 32/50 (64%) Frame = -1 Query: 291 FYCDACETERNPRHAVYYCEECEFIAHVRCVISEVCSNSVFHCFQKGRLN 142 +YCD CE ER P+H+VY C++C+FIAH+ C + +V + C L+ Sbjct: 132 YYCDICEEERKPKHSVYCCKKCKFIAHIECALKKVVDIKLDQCLTSSLLD 181 >ref|XP_007023006.1| Cysteine/Histidine-rich C1 domain family protein isoform 1 [Theobroma cacao] gi|508778372|gb|EOY25628.1| Cysteine/Histidine-rich C1 domain family protein isoform 1 [Theobroma cacao] Length = 909 Score = 58.9 bits (141), Expect = 7e-07 Identities = 21/50 (42%), Positives = 32/50 (64%) Frame = -1 Query: 291 FYCDACETERNPRHAVYYCEECEFIAHVRCVISEVCSNSVFHCFQKGRLN 142 +YCD CE ER P+H+VY C++C+FIAH+ C + +V + C L+ Sbjct: 292 YYCDICEEERKPKHSVYCCKKCKFIAHIECALKKVVDIKLDQCLTSSLLD 341 >ref|XP_007030357.1| Cysteine/Histidine-rich C1 domain family protein, putative [Theobroma cacao] gi|508718962|gb|EOY10859.1| Cysteine/Histidine-rich C1 domain family protein, putative [Theobroma cacao] Length = 823 Score = 58.9 bits (141), Expect = 7e-07 Identities = 20/34 (58%), Positives = 28/34 (82%) Frame = -1 Query: 291 FYCDACETERNPRHAVYYCEECEFIAHVRCVISE 190 +YCD CE ER+P H VYYC +C +IAH++CV++E Sbjct: 333 YYCDICEKERDPTHEVYYCRKCTYIAHIQCVLNE 366 >ref|XP_007023024.1| Cysteine/Histidine-rich C1 domain family protein, putative [Theobroma cacao] gi|508778390|gb|EOY25646.1| Cysteine/Histidine-rich C1 domain family protein, putative [Theobroma cacao] Length = 677 Score = 58.5 bits (140), Expect = 9e-07 Identities = 21/49 (42%), Positives = 32/49 (65%) Frame = -1 Query: 291 FYCDACETERNPRHAVYYCEECEFIAHVRCVISEVCSNSVFHCFQKGRL 145 +YCD CE ER P+H VY C++C+F+AH+ C +++V + H G L Sbjct: 248 YYCDICEEERKPKHHVYCCKKCKFVAHIECALNKVVDTKLDHGSASGLL 296 >ref|XP_007023019.1| Cysteine/Histidine-rich C1 domain family protein, putative [Theobroma cacao] gi|508778385|gb|EOY25641.1| Cysteine/Histidine-rich C1 domain family protein, putative [Theobroma cacao] Length = 765 Score = 57.8 bits (138), Expect = 2e-06 Identities = 18/42 (42%), Positives = 31/42 (73%) Frame = -1 Query: 291 FYCDACETERNPRHAVYYCEECEFIAHVRCVISEVCSNSVFH 166 +YCD CE ER P+H VY C++C+F+AH++C ++++ + H Sbjct: 323 YYCDICEEERKPKHHVYCCKKCKFVAHIQCALNKIIDTKLDH 364 >ref|XP_007023010.1| Cysteine/Histidine-rich C1 domain family protein, putative [Theobroma cacao] gi|508778376|gb|EOY25632.1| Cysteine/Histidine-rich C1 domain family protein, putative [Theobroma cacao] Length = 749 Score = 57.0 bits (136), Expect = 3e-06 Identities = 18/35 (51%), Positives = 30/35 (85%) Frame = -1 Query: 291 FYCDACETERNPRHAVYYCEECEFIAHVRCVISEV 187 +YCD CE +R P+H+VY C++C+F+AH+ CV+++V Sbjct: 264 YYCDICEEKRKPKHSVYCCKKCKFVAHIECVLNKV 298 >ref|XP_007030367.1| Cysteine/Histidine-rich C1 domain family protein, putative [Theobroma cacao] gi|508718972|gb|EOY10869.1| Cysteine/Histidine-rich C1 domain family protein, putative [Theobroma cacao] Length = 779 Score = 56.2 bits (134), Expect = 5e-06 Identities = 18/34 (52%), Positives = 28/34 (82%) Frame = -1 Query: 291 FYCDACETERNPRHAVYYCEECEFIAHVRCVISE 190 +YCD CE ER+P H VYYC++C +I H++CV+++ Sbjct: 334 YYCDICEEERDPTHQVYYCKKCTYITHIQCVLNK 367 >ref|XP_006464498.1| PREDICTED: uncharacterized protein LOC102623574 [Citrus sinensis] Length = 1057 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/33 (66%), Positives = 26/33 (78%) Frame = -1 Query: 285 CDACETERNPRHAVYYCEECEFIAHVRCVISEV 187 CDAC ERNP+H Y C ECE+ AHVRCV++EV Sbjct: 499 CDACGEERNPKHPYYCCVECEYNAHVRCVLTEV 531 >ref|XP_006427961.1| hypothetical protein CICLE_v10027263mg, partial [Citrus clementina] gi|557529951|gb|ESR41201.1| hypothetical protein CICLE_v10027263mg, partial [Citrus clementina] Length = 726 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/33 (66%), Positives = 26/33 (78%) Frame = -1 Query: 285 CDACETERNPRHAVYYCEECEFIAHVRCVISEV 187 CDAC ERNP+H Y C ECE+ AHVRCV++EV Sbjct: 385 CDACGEERNPKHPYYCCVECEYNAHVRCVLTEV 417 >gb|EXB50271.1| hypothetical protein L484_017808 [Morus notabilis] Length = 582 Score = 55.5 bits (132), Expect = 8e-06 Identities = 19/35 (54%), Positives = 26/35 (74%) Frame = -1 Query: 291 FYCDACETERNPRHAVYYCEECEFIAHVRCVISEV 187 +YCD CE ER+ +YYCEEC + AH+ C+ISE+ Sbjct: 231 YYCDVCEEERDKSFRIYYCEECTYAAHIHCLISEI 265 >ref|XP_007023017.1| Cysteine/Histidine-rich C1 domain family protein [Theobroma cacao] gi|508778383|gb|EOY25639.1| Cysteine/Histidine-rich C1 domain family protein [Theobroma cacao] Length = 748 Score = 55.5 bits (132), Expect = 8e-06 Identities = 17/35 (48%), Positives = 29/35 (82%) Frame = -1 Query: 291 FYCDACETERNPRHAVYYCEECEFIAHVRCVISEV 187 +YCD CE ER P+H+V+ C++C+F+AH+ C +++V Sbjct: 131 YYCDICEEERKPKHSVFCCKKCKFVAHIECALNKV 165