BLASTX nr result
ID: Paeonia22_contig00033953
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00033953 (422 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272339.1| PREDICTED: pentatricopeptide repeat-containi... 100 4e-19 ref|XP_007219476.1| hypothetical protein PRUPE_ppa021440mg, part... 92 6e-17 gb|EXB44293.1| hypothetical protein L484_012212 [Morus notabilis] 87 3e-15 ref|XP_004308191.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 77 3e-12 ref|XP_007010632.1| Pentatricopeptide repeat-containing protein,... 65 1e-08 ref|XP_002886049.1| pentatricopeptide repeat-containing protein ... 65 1e-08 ref|XP_006300135.1| hypothetical protein CARUB_v10016364mg [Caps... 63 4e-08 gb|AAS99720.1| At2g19280 [Arabidopsis thaliana] gi|62319953|dbj|... 60 4e-07 ref|NP_179518.1| pentatricopeptide repeat-containing protein [Ar... 60 4e-07 >ref|XP_002272339.1| PREDICTED: pentatricopeptide repeat-containing protein At2g19280 [Vitis vinifera] Length = 644 Score = 99.8 bits (247), Expect = 4e-19 Identities = 49/87 (56%), Positives = 66/87 (75%), Gaps = 1/87 (1%) Frame = +2 Query: 155 NEIFPSGNDKREFLAKDDSMSKNQKAAD-EVKTIKLILTKRIWNIHSQNGYKIDLNEFSI 331 N + ND ++ KD +S+N+KA D E++ IK+ILT R WN+ SQNGY+IDL++F++ Sbjct: 4 NGLSSGENDIFAYVDKDSLISENEKAVDDEMEIIKVILTNRGWNLGSQNGYRIDLSQFNV 63 Query: 332 MQILNDVFEESLDAELALYFF*WSECC 412 M+ILND+FEES DA LALYFF WSE C Sbjct: 64 MKILNDLFEESTDAALALYFFRWSEYC 90 >ref|XP_007219476.1| hypothetical protein PRUPE_ppa021440mg, partial [Prunus persica] gi|462415938|gb|EMJ20675.1| hypothetical protein PRUPE_ppa021440mg, partial [Prunus persica] Length = 675 Score = 92.4 bits (228), Expect = 6e-17 Identities = 54/136 (39%), Positives = 83/136 (61%), Gaps = 3/136 (2%) Frame = +2 Query: 17 KYCSAGNTVLSSFL--EEDQYILENFISIDNDDPLPNIKCISAESKKSNEIFPSGNDKRE 190 +Y S+ N+ LSS + E++ LE+ ++ DN L + K + + NE++ + E Sbjct: 26 RYYSSVNSALSSIILSEDETSTLEDTVAADNGIFL-SAKSYPTDFRGINELYCGEDGVCE 84 Query: 191 FLAKDDSMSKNQKA-ADEVKTIKLILTKRIWNIHSQNGYKIDLNEFSIMQILNDVFEESL 367 + S N++ DE+K + LIL KR WN+ QNGY I LN+ + +++LND+FEES Sbjct: 85 PVDTGFLFSINERPDEDEMKRLMLILAKRGWNLGCQNGYNIYLNQLNTIELLNDLFEESF 144 Query: 368 DAELALYFF*WSECCT 415 DA+L LYFF WSECC+ Sbjct: 145 DAKLVLYFFKWSECCS 160 >gb|EXB44293.1| hypothetical protein L484_012212 [Morus notabilis] Length = 710 Score = 86.7 bits (213), Expect = 3e-15 Identities = 52/137 (37%), Positives = 76/137 (55%), Gaps = 2/137 (1%) Frame = +2 Query: 2 INRISKYCSAGNTVLSSFLE-EDQYILENFISIDNDDPLPNIKCISAESKKSNEIFPSGN 178 + R +Y S+ N L+S + ED ++ D P C S E ++ +E+ Sbjct: 19 VRRAFRYYSSRNFALTSTSQLEDSCLVSEDSDSAKDTKSPKANCNSCERRERDELSFDKK 78 Query: 179 DKREFLAKDDSMSKNQKA-ADEVKTIKLILTKRIWNIHSQNGYKIDLNEFSIMQILNDVF 355 D E +D NQKA EV I +L R W++ S NGY++ L+E +I++I++D+F Sbjct: 79 DGDEVAERDFLFLTNQKAKVREVGRITRVLKNRGWDLTSPNGYRVKLSEVNIIRIMDDLF 138 Query: 356 EESLDAELALYFF*WSE 406 EES DAELALYFF WSE Sbjct: 139 EESSDAELALYFFTWSE 155 >ref|XP_004308191.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g19280-like [Fragaria vesca subsp. vesca] Length = 599 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/57 (63%), Positives = 44/57 (77%) Frame = +2 Query: 242 VKTIKLILTKRIWNIHSQNGYKIDLNEFSIMQILNDVFEESLDAELALYFF*WSECC 412 +K I LIL KR W+ QNGY I N+F+I+++LN +FEESLDA LALYFF WSECC Sbjct: 1 MKRIMLILAKRPWSRGCQNGYNIYRNQFNIVKVLNYLFEESLDANLALYFFKWSECC 57 >ref|XP_007010632.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|590567863|ref|XP_007010633.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508727545|gb|EOY19442.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508727546|gb|EOY19443.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] Length = 661 Score = 64.7 bits (156), Expect = 1e-08 Identities = 34/67 (50%), Positives = 45/67 (67%) Frame = +2 Query: 212 MSKNQKAADEVKTIKLILTKRIWNIHSQNGYKIDLNEFSIMQILNDVFEESLDAELALYF 391 ++++ + + + IK IL KR WNI+ N ID NE S++ IL +FEESLDAELALYF Sbjct: 41 ITQHSQVCNPLSLIKSILWKRGWNINPDNLCPIDFNESSVIGILTHLFEESLDAELALYF 100 Query: 392 F*WSECC 412 F SE C Sbjct: 101 FKLSERC 107 >ref|XP_002886049.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297331889|gb|EFH62308.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 755 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/68 (44%), Positives = 51/68 (75%), Gaps = 1/68 (1%) Frame = +2 Query: 206 DSMSKN-QKAADEVKTIKLILTKRIWNIHSQNGYKIDLNEFSIMQILNDVFEESLDAELA 382 D++ KN +D V+TI+ +LTK W ++G+ +L+++++++IL+D+FEE+LDA +A Sbjct: 137 DTILKNIDVPSDCVETIRNVLTKHSWIQKYESGFSTELDQYNVIRILDDLFEETLDASIA 196 Query: 383 LYFF*WSE 406 LYFF WSE Sbjct: 197 LYFFRWSE 204 >ref|XP_006300135.1| hypothetical protein CARUB_v10016364mg [Capsella rubella] gi|482568844|gb|EOA33033.1| hypothetical protein CARUB_v10016364mg [Capsella rubella] Length = 696 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/68 (42%), Positives = 51/68 (75%), Gaps = 1/68 (1%) Frame = +2 Query: 206 DSMSKNQKAADE-VKTIKLILTKRIWNIHSQNGYKIDLNEFSIMQILNDVFEESLDAELA 382 DS+ +N + ++ V+TI+ +L K W ++G+ +L+++S+++IL+D+FEE+LDA +A Sbjct: 78 DSILRNIEVPNDCVETIRDVLMKHSWIQKHESGFSSELDQYSVIRILDDLFEETLDASIA 137 Query: 383 LYFF*WSE 406 LYFF WSE Sbjct: 138 LYFFRWSE 145 >gb|AAS99720.1| At2g19280 [Arabidopsis thaliana] gi|62319953|dbj|BAD94048.1| putative salt-inducible protein [Arabidopsis thaliana] gi|110738808|dbj|BAF01327.1| putative salt-inducible protein [Arabidopsis thaliana] Length = 693 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/57 (43%), Positives = 43/57 (75%) Frame = +2 Query: 236 DEVKTIKLILTKRIWNIHSQNGYKIDLNEFSIMQILNDVFEESLDAELALYFF*WSE 406 D V+TI+ +L K W ++G+ +L+++++++IL+D+FEE+LDA + LYFF WSE Sbjct: 81 DCVETIRNVLVKHNWIQKYESGFSTELDQYTVIRILDDLFEETLDASIVLYFFRWSE 137 >ref|NP_179518.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|334184304|ref|NP_001189552.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|218546774|sp|Q6NKW7.2|PP164_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g19280 gi|3135258|gb|AAC16458.1| putative salt-inducible protein [Arabidopsis thaliana] gi|330251769|gb|AEC06863.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|330251770|gb|AEC06864.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 693 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/57 (43%), Positives = 43/57 (75%) Frame = +2 Query: 236 DEVKTIKLILTKRIWNIHSQNGYKIDLNEFSIMQILNDVFEESLDAELALYFF*WSE 406 D V+TI+ +L K W ++G+ +L+++++++IL+D+FEE+LDA + LYFF WSE Sbjct: 81 DCVETIRNVLVKHNWIQKYESGFSTELDQYTVIRILDDLFEETLDASIVLYFFRWSE 137