BLASTX nr result
ID: Paeonia22_contig00033948
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00033948 (511 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275784.1| PREDICTED: pentatricopeptide repeat-containi... 71 2e-10 ref|XP_002518995.1| GTP-binding protein alpha subunit, gna, put... 61 1e-07 ref|XP_006432677.1| hypothetical protein CICLE_v10000638mg [Citr... 59 9e-07 >ref|XP_002275784.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31920 [Vitis vinifera] gi|297742017|emb|CBI33804.3| unnamed protein product [Vitis vinifera] Length = 605 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/48 (64%), Positives = 41/48 (85%) Frame = +2 Query: 368 MIRTSVLHQTHLLAAQENSPQDPEVILRLREKDCLSSLKKCTNMKEFK 511 MIRTSVLHQTH+L ++E+ PQ PE+ +L EK+C+S LKKC+NM+EFK Sbjct: 1 MIRTSVLHQTHVLVSREDPPQSPELSFKLGEKECVSLLKKCSNMEEFK 48 >ref|XP_002518995.1| GTP-binding protein alpha subunit, gna, putative [Ricinus communis] gi|223541982|gb|EEF43528.1| GTP-binding protein alpha subunit, gna, putative [Ricinus communis] Length = 1203 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/52 (51%), Positives = 39/52 (75%) Frame = +2 Query: 356 VKDRMIRTSVLHQTHLLAAQENSPQDPEVILRLREKDCLSSLKKCTNMKEFK 511 V+ MI T+VLHQ H+L E+ + PEV LR++E++CLS LK+C NM+EF+ Sbjct: 858 VRAEMIGTTVLHQIHILLPPEDPSESPEVSLRVKEQECLSLLKRCQNMEEFR 909 >ref|XP_006432677.1| hypothetical protein CICLE_v10000638mg [Citrus clementina] gi|568834767|ref|XP_006471474.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31920-like [Citrus sinensis] gi|557534799|gb|ESR45917.1| hypothetical protein CICLE_v10000638mg [Citrus clementina] Length = 605 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/48 (56%), Positives = 36/48 (75%) Frame = +2 Query: 368 MIRTSVLHQTHLLAAQENSPQDPEVILRLREKDCLSSLKKCTNMKEFK 511 M RTSVLHQ+ LL E P+ PE+ LRL+E++CL+ LK C N++EFK Sbjct: 1 MTRTSVLHQSLLLTQPEEPPKGPELNLRLKEQECLTILKTCKNLEEFK 48