BLASTX nr result
ID: Paeonia22_contig00033841
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00033841 (214 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006421514.1| hypothetical protein CICLE_v10005097mg [Citr... 60 2e-07 ref|XP_006421544.1| hypothetical protein CICLE_v10006867mg [Citr... 58 2e-06 >ref|XP_006421514.1| hypothetical protein CICLE_v10005097mg [Citrus clementina] gi|557523387|gb|ESR34754.1| hypothetical protein CICLE_v10005097mg [Citrus clementina] Length = 402 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/76 (36%), Positives = 42/76 (55%), Gaps = 9/76 (11%) Frame = +1 Query: 1 SNWFVKYHVDFDRAIPDLGPLNAD---------NGQFSVLHLVRGVNEEESYLVLHLHGM 153 S WFVKYHVD D I ++A ++S+L ++R N+EE Y+VLH+ G Sbjct: 296 SGWFVKYHVDLDALIDAFPEIDASLDDFQQPSAYNEYSILGIIREANDEEPYMVLHIPGK 355 Query: 154 IVFYNFKNEKLEKLCD 201 + YN ++ K+CD Sbjct: 356 AIRYNLNDKTFTKICD 371 >ref|XP_006421544.1| hypothetical protein CICLE_v10006867mg [Citrus clementina] gi|557523417|gb|ESR34784.1| hypothetical protein CICLE_v10006867mg [Citrus clementina] Length = 407 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/77 (37%), Positives = 48/77 (62%), Gaps = 8/77 (10%) Frame = +1 Query: 1 SNWFVKYHVDFD---RAIPDL-----GPLNADNGQFSVLHLVRGVNEEESYLVLHLHGMI 156 S WFVKYHVD A P++ P + D ++S+L +VR N+++SY++LHL + Sbjct: 302 SGWFVKYHVDLGGVTAAFPEMIRTYRDPQDLDYYEYSILGVVREENDDDSYMLLHLPNKV 361 Query: 157 VFYNFKNEKLEKLCDLA 207 V Y+ K+ L+++ D+A Sbjct: 362 VHYDLKDNTLKEVLDVA 378