BLASTX nr result
ID: Paeonia22_contig00033749
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00033749 (402 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETI21314.1| thioredoxin [Cladophialophora carrionii CBS 160.54] 80 2e-13 gb|EXJ55755.1| hypothetical protein A1O7_08685 [Cladophialophora... 79 8e-13 gb|EXJ74742.1| thioredoxin 1 [Cladophialophora psammophila CBS 1... 73 4e-11 ref|XP_001799253.1| hypothetical protein SNOG_08948 [Phaeosphaer... 71 2e-10 gb|EHY52682.1| thioredoxin 1 [Exophiala dermatitidis NIH/UT8656] 70 4e-10 gb|EXJ94520.1| thioredoxin 1 [Capronia coronata CBS 617.96] 69 5e-10 gb|ETN42133.1| thioredoxin [Cyphellophora europaea CBS 101466] 69 9e-10 gb|EXJ84451.1| thioredoxin 1 [Capronia epimyces CBS 606.96] 68 1e-09 ref|XP_007585614.1| putative thioredoxin protein [Neofusicoccum ... 67 2e-09 ref|XP_003303420.1| hypothetical protein PTT_15618 [Pyrenophora ... 67 2e-09 ref|XP_001939504.1| thioredoxin [Pyrenophora tritici-repentis Pt... 67 2e-09 gb|EME78407.1| hypothetical protein MYCFIDRAFT_205026 [Pseudocer... 67 3e-09 gb|EON61097.1| hypothetical protein W97_00308 [Coniosporium apol... 67 3e-09 gb|EKG13018.1| Thioredoxin [Macrophomina phaseolina MS6] 67 3e-09 gb|EUC45458.1| hypothetical protein COCMIDRAFT_95543 [Bipolaris ... 66 6e-09 gb|EUC31311.1| hypothetical protein COCCADRAFT_38558 [Bipolaris ... 66 6e-09 gb|EMD86195.1| hypothetical protein COCHEDRAFT_1228264 [Bipolari... 66 6e-09 gb|EMD69924.1| hypothetical protein COCSADRAFT_77303 [Bipolaris ... 65 1e-08 gb|EMC91960.1| hypothetical protein BAUCODRAFT_39110 [Baudoinia ... 65 1e-08 gb|EEH22651.1| thioredoxin [Paracoccidioides brasiliensis Pb03] ... 65 1e-08 >gb|ETI21314.1| thioredoxin [Cladophialophora carrionii CBS 160.54] Length = 141 Score = 80.5 bits (197), Expect = 2e-13 Identities = 43/67 (64%), Positives = 47/67 (70%) Frame = -3 Query: 400 VLKYSNSXXXXXXXXXXXXXXXXVPDVAQELSVRAMPTFMFFKNGEKVAEVVGANSRAIE 221 VLK+SNS VPDVAQEL VRAMPTFMFFKNGEKV EVVGAN RA+E Sbjct: 75 VLKFSNSEQYKDKVDFYKVDVDEVPDVAQELGVRAMPTFMFFKNGEKVDEVVGANVRALE 134 Query: 220 ATIRKHL 200 A I+KH+ Sbjct: 135 AAIQKHI 141 >gb|EXJ55755.1| hypothetical protein A1O7_08685 [Cladophialophora yegresii CBS 114405] Length = 142 Score = 78.6 bits (192), Expect = 8e-13 Identities = 42/67 (62%), Positives = 47/67 (70%) Frame = -3 Query: 400 VLKYSNSXXXXXXXXXXXXXXXXVPDVAQELSVRAMPTFMFFKNGEKVAEVVGANSRAIE 221 VLK+SNS VPDVAQEL VRAMPTFMFFKNGEKV EVVGA+ RA+E Sbjct: 76 VLKFSNSDEYKDKVDFYKVDVDEVPDVAQELGVRAMPTFMFFKNGEKVDEVVGADVRALE 135 Query: 220 ATIRKHL 200 A I+KH+ Sbjct: 136 AAIKKHV 142 >gb|EXJ74742.1| thioredoxin 1 [Cladophialophora psammophila CBS 110553] Length = 141 Score = 73.2 bits (178), Expect = 4e-11 Identities = 40/67 (59%), Positives = 43/67 (64%) Frame = -3 Query: 400 VLKYSNSXXXXXXXXXXXXXXXXVPDVAQELSVRAMPTFMFFKNGEKVAEVVGANSRAIE 221 V K+S S VPDVAQEL VRAMPTFM FKNGEKV EVVGAN A+E Sbjct: 75 VAKFSESDDFKDKVDFYKVDVDEVPDVAQELGVRAMPTFMIFKNGEKVGEVVGANKHALE 134 Query: 220 ATIRKHL 200 A IRK+L Sbjct: 135 AAIRKNL 141 >ref|XP_001799253.1| hypothetical protein SNOG_08948 [Phaeosphaeria nodorum SN15] gi|111062996|gb|EAT84116.1| hypothetical protein SNOG_08948 [Phaeosphaeria nodorum SN15] Length = 159 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = -3 Query: 328 PDVAQELSVRAMPTFMFFKNGEKVAEVVGANSRAIEATIRKH 203 PD+AQEL +RAMPTF+FFKNGEKV EVVGAN +AIEA I++H Sbjct: 115 PDIAQELGIRAMPTFVFFKNGEKVGEVVGANPKAIEAGIQEH 156 >gb|EHY52682.1| thioredoxin 1 [Exophiala dermatitidis NIH/UT8656] Length = 110 Score = 69.7 bits (169), Expect = 4e-10 Identities = 37/67 (55%), Positives = 43/67 (64%) Frame = -3 Query: 400 VLKYSNSXXXXXXXXXXXXXXXXVPDVAQELSVRAMPTFMFFKNGEKVAEVVGANSRAIE 221 ++K+S S VPDVAQEL VRAMPTFM FKNG+KV EVVGAN RA+E Sbjct: 44 LVKFSESDEFKDKVDFYKIDVDEVPDVAQELGVRAMPTFMLFKNGQKVGEVVGANKRALE 103 Query: 220 ATIRKHL 200 IR +L Sbjct: 104 QAIRSNL 110 >gb|EXJ94520.1| thioredoxin 1 [Capronia coronata CBS 617.96] Length = 159 Score = 69.3 bits (168), Expect = 5e-10 Identities = 37/64 (57%), Positives = 42/64 (65%) Frame = -3 Query: 400 VLKYSNSXXXXXXXXXXXXXXXXVPDVAQELSVRAMPTFMFFKNGEKVAEVVGANSRAIE 221 ++K+S S VPDVAQEL VRAMPTFM FKNGEKVAEVVGAN +A+E Sbjct: 93 LVKFSESEEFKDKVDFYKIDVDEVPDVAQELGVRAMPTFMLFKNGEKVAEVVGANKKALE 152 Query: 220 ATIR 209 IR Sbjct: 153 QAIR 156 >gb|ETN42133.1| thioredoxin [Cyphellophora europaea CBS 101466] Length = 140 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -3 Query: 328 PDVAQELSVRAMPTFMFFKNGEKVAEVVGANSRAIEATIRKHL 200 PDVAQEL +RAMPTF+ FKNGE+V E+VGAN RAI A + KHL Sbjct: 98 PDVAQELGIRAMPTFLVFKNGEQVEEIVGANERAIRAAVDKHL 140 >gb|EXJ84451.1| thioredoxin 1 [Capronia epimyces CBS 606.96] Length = 149 Score = 68.2 bits (165), Expect = 1e-09 Identities = 36/67 (53%), Positives = 42/67 (62%) Frame = -3 Query: 400 VLKYSNSXXXXXXXXXXXXXXXXVPDVAQELSVRAMPTFMFFKNGEKVAEVVGANSRAIE 221 ++K+S S +PDVAQEL VRAMPTFM FK GEKV EVVGAN RA+E Sbjct: 83 LVKFSESEEFKDKADFYKIDVDELPDVAQELGVRAMPTFMLFKGGEKVGEVVGANKRALE 142 Query: 220 ATIRKHL 200 IR +L Sbjct: 143 QAIRANL 149 >ref|XP_007585614.1| putative thioredoxin protein [Neofusicoccum parvum UCRNP2] gi|485921102|gb|EOD46908.1| putative thioredoxin protein [Neofusicoccum parvum UCRNP2] Length = 107 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -3 Query: 328 PDVAQELSVRAMPTFMFFKNGEKVAEVVGANSRAIEATIRKH 203 PDVAQEL +RAMPTF+ FK GEKV EVVGAN +A+EA I++H Sbjct: 63 PDVAQELGIRAMPTFLLFKGGEKVGEVVGANPKALEAAIKQH 104 >ref|XP_003303420.1| hypothetical protein PTT_15618 [Pyrenophora teres f. teres 0-1] gi|311320594|gb|EFQ88475.1| hypothetical protein PTT_15618 [Pyrenophora teres f. teres 0-1] Length = 158 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/43 (69%), Positives = 38/43 (88%) Frame = -3 Query: 328 PDVAQELSVRAMPTFMFFKNGEKVAEVVGANSRAIEATIRKHL 200 PDVAQEL +RAMPTF+FFK G+KVAEVVGAN +A+EA I+ ++ Sbjct: 115 PDVAQELGIRAMPTFLFFKGGDKVAEVVGANPKALEAAIQSNI 157 >ref|XP_001939504.1| thioredoxin [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187975597|gb|EDU42223.1| thioredoxin [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 111 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/43 (69%), Positives = 38/43 (88%) Frame = -3 Query: 328 PDVAQELSVRAMPTFMFFKNGEKVAEVVGANSRAIEATIRKHL 200 PDVAQEL +RAMPTF+FFK G+KVAEVVGAN +A+EA I+ ++ Sbjct: 68 PDVAQELGIRAMPTFLFFKGGDKVAEVVGANPKALEAAIQSNI 110 >gb|EME78407.1| hypothetical protein MYCFIDRAFT_205026 [Pseudocercospora fijiensis CIRAD86] Length = 107 Score = 67.0 bits (162), Expect = 3e-09 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = -3 Query: 328 PDVAQELSVRAMPTFMFFKNGEKVAEVVGANSRAIEATIRKHL 200 PDVAQELSVRAMPTF FKNGEKV EVVGAN A+E I+++L Sbjct: 65 PDVAQELSVRAMPTFFLFKNGEKVGEVVGANPAALETAIKQNL 107 >gb|EON61097.1| hypothetical protein W97_00308 [Coniosporium apollinis CBS 100218] Length = 110 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = -3 Query: 328 PDVAQELSVRAMPTFMFFKNGEKVAEVVGANSRAIEATIRKHL 200 P+VAQEL +RAMPTF+ FKNGEKV EVVGAN +A+EA I+ +L Sbjct: 66 PEVAQELGIRAMPTFLLFKNGEKVGEVVGANPKALEAAIKSNL 108 >gb|EKG13018.1| Thioredoxin [Macrophomina phaseolina MS6] Length = 107 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -3 Query: 328 PDVAQELSVRAMPTFMFFKNGEKVAEVVGANSRAIEATIRKHL 200 PDVAQEL +RAMPTF+ FK GEKV EVVGAN +A++A I KH+ Sbjct: 62 PDVAQELGIRAMPTFLLFKGGEKVDEVVGANPKALQAAIEKHV 104 >gb|EUC45458.1| hypothetical protein COCMIDRAFT_95543 [Bipolaris oryzae ATCC 44560] Length = 158 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = -3 Query: 328 PDVAQELSVRAMPTFMFFKNGEKVAEVVGANSRAIEATIRKHL 200 PDVAQEL +RAMPTF+ FK G+KVAEVVGAN +A+EA I+ +L Sbjct: 115 PDVAQELGIRAMPTFLLFKGGDKVAEVVGANPKALEAAIKANL 157 >gb|EUC31311.1| hypothetical protein COCCADRAFT_38558 [Bipolaris zeicola 26-R-13] gi|578486808|gb|EUN24276.1| hypothetical protein COCVIDRAFT_106528 [Bipolaris victoriae FI3] Length = 158 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = -3 Query: 328 PDVAQELSVRAMPTFMFFKNGEKVAEVVGANSRAIEATIRKHL 200 PDVAQEL +RAMPTF+ FK G+KVAEVVGAN +A+EA I+ +L Sbjct: 115 PDVAQELGIRAMPTFLLFKGGDKVAEVVGANPKALEAAIKANL 157 >gb|EMD86195.1| hypothetical protein COCHEDRAFT_1228264 [Bipolaris maydis C5] gi|477589067|gb|ENI06144.1| hypothetical protein COCC4DRAFT_135611 [Bipolaris maydis ATCC 48331] Length = 110 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = -3 Query: 328 PDVAQELSVRAMPTFMFFKNGEKVAEVVGANSRAIEATIRKHL 200 PDVAQEL +RAMPTF+ FK G+KVAEVVGAN +A+EA I+ +L Sbjct: 67 PDVAQELGIRAMPTFLLFKGGDKVAEVVGANPKALEAAIKANL 109 >gb|EMD69924.1| hypothetical protein COCSADRAFT_77303 [Bipolaris sorokiniana ND90Pr] Length = 158 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -3 Query: 328 PDVAQELSVRAMPTFMFFKNGEKVAEVVGANSRAIEATIRKHL 200 PDVAQEL +RAMPTF FK G+KVAEVVGAN +A+EA I+ +L Sbjct: 115 PDVAQELGIRAMPTFFLFKGGDKVAEVVGANPKALEAAIKANL 157 >gb|EMC91960.1| hypothetical protein BAUCODRAFT_39110 [Baudoinia compniacensis UAMH 10762] Length = 108 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -3 Query: 328 PDVAQELSVRAMPTFMFFKNGEKVAEVVGANSRAIEATIRKHL 200 P+VAQEL+VRAMPTF+ FKNGEKV EVVGAN A+E I+ +L Sbjct: 66 PEVAQELAVRAMPTFLLFKNGEKVGEVVGANPSALETAIKSNL 108 >gb|EEH22651.1| thioredoxin [Paracoccidioides brasiliensis Pb03] gi|226294005|gb|EEH49425.1| thioredoxin [Paracoccidioides brasiliensis Pb18] Length = 117 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -3 Query: 328 PDVAQELSVRAMPTFMFFKNGEKVAEVVGANSRAIEATIRKH 203 PD+AQEL VRAMPTF+FFK+G+KV EV+GA +A+EA I+KH Sbjct: 74 PDIAQELGVRAMPTFIFFKDGQKVDEVMGAVPQAVEAAIKKH 115