BLASTX nr result
ID: Paeonia22_contig00033735
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00033735 (615 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB84222.1| putative phosphatidylinositol 4-kinase type 2-bet... 70 6e-10 ref|XP_007219205.1| hypothetical protein PRUPE_ppa017046mg [Prun... 65 2e-08 ref|XP_007039041.1| Phosphatidylinositol 3- and 4-kinase,Ubiquit... 65 2e-08 emb|CBI23006.3| unnamed protein product [Vitis vinifera] 65 2e-08 ref|XP_002277933.1| PREDICTED: probable phosphatidylinositol 4-k... 65 2e-08 ref|XP_004494822.1| PREDICTED: uncharacterized protein LOC101509... 64 3e-08 ref|XP_004494821.1| PREDICTED: uncharacterized protein LOC101509... 64 3e-08 gb|ACR34675.1| unknown [Zea mays] 64 3e-08 ref|NP_001147061.1| phosphatidylinositol 3- and 4-kinase family ... 64 3e-08 ref|NP_001142051.1| uncharacterized protein LOC100274207 [Zea ma... 64 3e-08 gb|ABR25892.1| phosphatidylinositol 3- and 4-kinase family [Oryz... 64 3e-08 gb|EAZ00815.1| hypothetical protein OsI_22845 [Oryza sativa Indi... 64 3e-08 ref|XP_006397840.1| hypothetical protein EUTSA_v10001379mg [Eutr... 64 5e-08 ref|XP_004306671.1| PREDICTED: uncharacterized protein LOC101313... 64 5e-08 ref|XP_004140586.1| PREDICTED: uncharacterized protein LOC101209... 64 5e-08 emb|CBI40551.3| unnamed protein product [Vitis vinifera] 64 5e-08 ref|XP_002263546.1| PREDICTED: probable phosphatidylinositol 4-k... 64 5e-08 emb|CAN82992.1| hypothetical protein VITISV_009587 [Vitis vinifera] 64 5e-08 ref|XP_006441081.1| hypothetical protein CICLE_v10019418mg [Citr... 63 8e-08 ref|XP_004965456.1| PREDICTED: probable phosphatidylinositol 4-k... 63 8e-08 >gb|EXB84222.1| putative phosphatidylinositol 4-kinase type 2-beta [Morus notabilis] Length = 660 Score = 69.7 bits (169), Expect = 6e-10 Identities = 43/93 (46%), Positives = 51/93 (54%), Gaps = 7/93 (7%) Frame = -3 Query: 613 VPIDHGCCLP-------LEWLYTYMCWHLQEIARIPYSQVLLLSIEELDSVNDIETLRVH 455 VPIDHG CLP EWLY W AR PYS +L I+ LD+ DIE L+ H Sbjct: 522 VPIDHGYCLPESFEDCTFEWLY----W---PQARQPYSPDILDYIKSLDAEQDIELLKFH 574 Query: 454 AIELPFKSILGFEASTYVLKEGARRKLTPYELG 356 LP K F ST +LK+GA R LTP+ +G Sbjct: 575 GWNLPPKCARNFRISTMLLKKGAERGLTPFTIG 607 >ref|XP_007219205.1| hypothetical protein PRUPE_ppa017046mg [Prunus persica] gi|462415667|gb|EMJ20404.1| hypothetical protein PRUPE_ppa017046mg [Prunus persica] Length = 578 Score = 65.1 bits (157), Expect = 2e-08 Identities = 36/86 (41%), Positives = 47/86 (54%) Frame = -3 Query: 613 VPIDHGCCLPLEWLYTYMCWHLQEIARIPYSQVLLLSIEELDSVNDIETLRVHAIELPFK 434 +PIDHG CLP + W A PYS L I+ LD+ DIE L+ H +LP + Sbjct: 443 IPIDHGYCLPENFEDCTFDWLYWPQAHQPYSSDTLEYIKSLDAEQDIELLKFHGWDLPPE 502 Query: 433 SILGFEASTYVLKEGARRKLTPYELG 356 S ST +LK+GA R LTP+ +G Sbjct: 503 SARTLRISTMLLKKGAERGLTPFAIG 528 >ref|XP_007039041.1| Phosphatidylinositol 3- and 4-kinase,Ubiquitin family protein [Theobroma cacao] gi|508776286|gb|EOY23542.1| Phosphatidylinositol 3- and 4-kinase,Ubiquitin family protein [Theobroma cacao] Length = 516 Score = 64.7 bits (156), Expect = 2e-08 Identities = 35/86 (40%), Positives = 47/86 (54%) Frame = -3 Query: 613 VPIDHGCCLPLEWLYTYMCWHLQEIARIPYSQVLLLSIEELDSVNDIETLRVHAIELPFK 434 VPIDHG CLP + W A PY+ ++ I+ LD+ DIE L+ H ++P K Sbjct: 380 VPIDHGYCLPENFEDCTFDWLYWPQAHEPYTPGVINYIKSLDAEKDIELLKFHGWDMPPK 439 Query: 433 SILGFEASTYVLKEGARRKLTPYELG 356 ST +LK+GA R LTPY +G Sbjct: 440 CARTLRISTMLLKKGAERGLTPYSIG 465 >emb|CBI23006.3| unnamed protein product [Vitis vinifera] Length = 455 Score = 64.7 bits (156), Expect = 2e-08 Identities = 35/86 (40%), Positives = 46/86 (53%) Frame = -3 Query: 613 VPIDHGCCLPLEWLYTYMCWHLQEIARIPYSQVLLLSIEELDSVNDIETLRVHAIELPFK 434 +PIDHG CLP + W A+IPYS + I LD+ DIE L+ H LP + Sbjct: 319 IPIDHGYCLPENFEDCTFDWLYWPQAKIPYSPDTIDYIRSLDAEKDIELLKFHGWNLPLE 378 Query: 433 SILGFEASTYVLKEGARRKLTPYELG 356 ST +LK+GA R LTP+ +G Sbjct: 379 CARTLRISTMLLKKGAERGLTPFIIG 404 >ref|XP_002277933.1| PREDICTED: probable phosphatidylinositol 4-kinase type 2-beta At1g26270-like [Vitis vinifera] Length = 585 Score = 64.7 bits (156), Expect = 2e-08 Identities = 35/86 (40%), Positives = 46/86 (53%) Frame = -3 Query: 613 VPIDHGCCLPLEWLYTYMCWHLQEIARIPYSQVLLLSIEELDSVNDIETLRVHAIELPFK 434 +PIDHG CLP + W A+IPYS + I LD+ DIE L+ H LP + Sbjct: 449 IPIDHGYCLPENFEDCTFDWLYWPQAKIPYSPDTIDYIRSLDAEKDIELLKFHGWNLPLE 508 Query: 433 SILGFEASTYVLKEGARRKLTPYELG 356 ST +LK+GA R LTP+ +G Sbjct: 509 CARTLRISTMLLKKGAERGLTPFIIG 534 >ref|XP_004494822.1| PREDICTED: uncharacterized protein LOC101509818 isoform X2 [Cicer arietinum] Length = 569 Score = 64.3 bits (155), Expect = 3e-08 Identities = 35/86 (40%), Positives = 45/86 (52%) Frame = -3 Query: 613 VPIDHGCCLPLEWLYTYMCWHLQEIARIPYSQVLLLSIEELDSVNDIETLRVHAIELPFK 434 VPIDHG CLP + W AR PYS + I+ LD+ DI L+ H +LP + Sbjct: 430 VPIDHGYCLPTSFEDCTFEWLYWPQARKPYSPETIEYIKSLDAEEDIALLKFHGWDLPIE 489 Query: 433 SILGFEASTYVLKEGARRKLTPYELG 356 ST +LK+G R LTPY +G Sbjct: 490 CARTLRISTMLLKKGVERGLTPYAIG 515 >ref|XP_004494821.1| PREDICTED: uncharacterized protein LOC101509818 isoform X1 [Cicer arietinum] Length = 591 Score = 64.3 bits (155), Expect = 3e-08 Identities = 35/86 (40%), Positives = 45/86 (52%) Frame = -3 Query: 613 VPIDHGCCLPLEWLYTYMCWHLQEIARIPYSQVLLLSIEELDSVNDIETLRVHAIELPFK 434 VPIDHG CLP + W AR PYS + I+ LD+ DI L+ H +LP + Sbjct: 452 VPIDHGYCLPTSFEDCTFEWLYWPQARKPYSPETIEYIKSLDAEEDIALLKFHGWDLPIE 511 Query: 433 SILGFEASTYVLKEGARRKLTPYELG 356 ST +LK+G R LTPY +G Sbjct: 512 CARTLRISTMLLKKGVERGLTPYAIG 537 >gb|ACR34675.1| unknown [Zea mays] Length = 568 Score = 63.9 bits (154), Expect = 3e-08 Identities = 34/86 (39%), Positives = 48/86 (55%) Frame = -3 Query: 613 VPIDHGCCLPLEWLYTYMCWHLQEIARIPYSQVLLLSIEELDSVNDIETLRVHAIELPFK 434 +PIDHG CLP ++ W AR P+S + I+ LD+ DI+ L+ H ELP + Sbjct: 434 IPIDHGYCLPEKFEDVTFEWLYWPQAREPFSDETIEYIKSLDAEEDIKLLKFHGWELPPR 493 Query: 433 SILGFEASTYVLKEGARRKLTPYELG 356 ST +LK+GA R TPY++G Sbjct: 494 CARVLRISTMLLKKGAARGFTPYDIG 519 >ref|NP_001147061.1| phosphatidylinositol 3- and 4-kinase family protein [Zea mays] gi|195606964|gb|ACG25312.1| phosphatidylinositol 3- and 4-kinase family protein [Zea mays] Length = 568 Score = 63.9 bits (154), Expect = 3e-08 Identities = 33/86 (38%), Positives = 49/86 (56%) Frame = -3 Query: 613 VPIDHGCCLPLEWLYTYMCWHLQEIARIPYSQVLLLSIEELDSVNDIETLRVHAIELPFK 434 +PIDHG CLP ++ W AR P++ + I+ LD+ DI+ L++H ELP + Sbjct: 434 IPIDHGYCLPEKFEDCTFEWLYWPQAREPFNDETIEYIKSLDAEEDIKLLKIHGWELPPR 493 Query: 433 SILGFEASTYVLKEGARRKLTPYELG 356 ST +LK+GA R TPY++G Sbjct: 494 CARVLRISTMLLKKGASRGFTPYDIG 519 >ref|NP_001142051.1| uncharacterized protein LOC100274207 [Zea mays] gi|194706926|gb|ACF87547.1| unknown [Zea mays] Length = 190 Score = 63.9 bits (154), Expect = 3e-08 Identities = 34/86 (39%), Positives = 48/86 (55%) Frame = -3 Query: 613 VPIDHGCCLPLEWLYTYMCWHLQEIARIPYSQVLLLSIEELDSVNDIETLRVHAIELPFK 434 +PIDHG CLP ++ W AR P+S + I+ LD+ DI+ L+ H ELP + Sbjct: 56 IPIDHGYCLPEKFEDVTFEWLYWPQAREPFSDETIEYIKSLDAEEDIKLLKFHGWELPPR 115 Query: 433 SILGFEASTYVLKEGARRKLTPYELG 356 ST +LK+GA R TPY++G Sbjct: 116 CARVLRISTMLLKKGAARGFTPYDIG 141 >gb|ABR25892.1| phosphatidylinositol 3- and 4-kinase family [Oryza sativa Indica Group] Length = 219 Score = 63.9 bits (154), Expect = 3e-08 Identities = 35/86 (40%), Positives = 48/86 (55%) Frame = -3 Query: 613 VPIDHGCCLPLEWLYTYMCWHLQEIARIPYSQVLLLSIEELDSVNDIETLRVHAIELPFK 434 VPIDHG CLP ++ W AR P+S + I+ LD+ DI+ L+ H EL + Sbjct: 99 VPIDHGYCLPEKFEDCTFEWLYWPQAREPFSDETIAYIKSLDAEEDIKLLKFHGWELSAR 158 Query: 433 SILGFEASTYVLKEGARRKLTPYELG 356 ST +LK+GA R LTPY++G Sbjct: 159 CARVLRISTMLLKKGAARGLTPYDIG 184 >gb|EAZ00815.1| hypothetical protein OsI_22845 [Oryza sativa Indica Group] Length = 568 Score = 63.9 bits (154), Expect = 3e-08 Identities = 35/86 (40%), Positives = 48/86 (55%) Frame = -3 Query: 613 VPIDHGCCLPLEWLYTYMCWHLQEIARIPYSQVLLLSIEELDSVNDIETLRVHAIELPFK 434 VPIDHG CLP ++ W AR P+S + I+ LD+ DI+ L+ H EL + Sbjct: 432 VPIDHGYCLPEKFEDCTFEWLYWPQAREPFSDETIAYIKSLDAEEDIKLLKFHGWELSAR 491 Query: 433 SILGFEASTYVLKEGARRKLTPYELG 356 ST +LK+GA R LTPY++G Sbjct: 492 CARVLRISTMLLKKGAARGLTPYDIG 517 >ref|XP_006397840.1| hypothetical protein EUTSA_v10001379mg [Eutrema salsugineum] gi|567166501|ref|XP_006397841.1| hypothetical protein EUTSA_v10001379mg [Eutrema salsugineum] gi|557098913|gb|ESQ39293.1| hypothetical protein EUTSA_v10001379mg [Eutrema salsugineum] gi|557098914|gb|ESQ39294.1| hypothetical protein EUTSA_v10001379mg [Eutrema salsugineum] Length = 564 Score = 63.5 bits (153), Expect = 5e-08 Identities = 39/93 (41%), Positives = 49/93 (52%), Gaps = 7/93 (7%) Frame = -3 Query: 613 VPIDHGCCLP-------LEWLYTYMCWHLQEIARIPYSQVLLLSIEELDSVNDIETLRVH 455 VPIDHG CLP EWLY W AR PYS L I LD+ DIE L+ H Sbjct: 424 VPIDHGYCLPESFEDCTFEWLY----W---PQARKPYSPETLDYIRSLDAEEDIELLKFH 476 Query: 454 AIELPFKSILGFEASTYVLKEGARRKLTPYELG 356 ++P ++ ST +LK+G R LT +E+G Sbjct: 477 GWKMPLETARTLRISTMLLKKGVERGLTAFEIG 509 >ref|XP_004306671.1| PREDICTED: uncharacterized protein LOC101313923 [Fragaria vesca subsp. vesca] Length = 591 Score = 63.5 bits (153), Expect = 5e-08 Identities = 32/86 (37%), Positives = 48/86 (55%) Frame = -3 Query: 613 VPIDHGCCLPLEWLYTYMCWHLQEIARIPYSQVLLLSIEELDSVNDIETLRVHAIELPFK 434 +PIDHG CLP + W AR PY++ ++ ++ LD+ DI L+ H E+P K Sbjct: 452 IPIDHGYCLPENFEDVTFDWLYWPQARKPYAEEVVDYVKSLDAEEDIALLKFHGWEMPPK 511 Query: 433 SILGFEASTYVLKEGARRKLTPYELG 356 ST +LK+G R LTP+++G Sbjct: 512 CARTLRISTMLLKKGVERGLTPFDIG 537 >ref|XP_004140586.1| PREDICTED: uncharacterized protein LOC101209114 [Cucumis sativus] gi|449523157|ref|XP_004168591.1| PREDICTED: uncharacterized LOC101209114 [Cucumis sativus] Length = 597 Score = 63.5 bits (153), Expect = 5e-08 Identities = 33/88 (37%), Positives = 47/88 (53%) Frame = -3 Query: 613 VPIDHGCCLPLEWLYTYMCWHLQEIARIPYSQVLLLSIEELDSVNDIETLRVHAIELPFK 434 +PIDHG CLP + W ++ PY L I LD+ DI L+ H +LP + Sbjct: 458 IPIDHGYCLPTSFEDCTFDWLYWPQSQQPYDAETLDYINSLDAEEDIALLKFHGWDLPLE 517 Query: 433 SILGFEASTYVLKEGARRKLTPYELGYF 350 ST +LK+GA+R LTP+++G F Sbjct: 518 CARTLRISTMLLKKGAKRGLTPFDIGSF 545 >emb|CBI40551.3| unnamed protein product [Vitis vinifera] Length = 527 Score = 63.5 bits (153), Expect = 5e-08 Identities = 37/93 (39%), Positives = 49/93 (52%), Gaps = 7/93 (7%) Frame = -3 Query: 613 VPIDHGCCLP-------LEWLYTYMCWHLQEIARIPYSQVLLLSIEELDSVNDIETLRVH 455 +PIDHG CLP EWLY W AR+PYS + I+ LD+ DI L+ H Sbjct: 391 IPIDHGYCLPESFEDCTFEWLY----W---PQARVPYSAATIRYIQSLDAEEDIALLQFH 443 Query: 454 AIELPFKSILGFEASTYVLKEGARRKLTPYELG 356 +LP + ST +LK+GA LTP+ +G Sbjct: 444 GWDLPLECARILRISTMLLKKGAELGLTPFAIG 476 >ref|XP_002263546.1| PREDICTED: probable phosphatidylinositol 4-kinase type 2-beta At1g26270-like [Vitis vinifera] Length = 576 Score = 63.5 bits (153), Expect = 5e-08 Identities = 37/93 (39%), Positives = 49/93 (52%), Gaps = 7/93 (7%) Frame = -3 Query: 613 VPIDHGCCLP-------LEWLYTYMCWHLQEIARIPYSQVLLLSIEELDSVNDIETLRVH 455 +PIDHG CLP EWLY W AR+PYS + I+ LD+ DI L+ H Sbjct: 440 IPIDHGYCLPESFEDCTFEWLY----W---PQARVPYSAATIRYIQSLDAEEDIALLQFH 492 Query: 454 AIELPFKSILGFEASTYVLKEGARRKLTPYELG 356 +LP + ST +LK+GA LTP+ +G Sbjct: 493 GWDLPLECARILRISTMLLKKGAELGLTPFAIG 525 >emb|CAN82992.1| hypothetical protein VITISV_009587 [Vitis vinifera] Length = 576 Score = 63.5 bits (153), Expect = 5e-08 Identities = 37/93 (39%), Positives = 49/93 (52%), Gaps = 7/93 (7%) Frame = -3 Query: 613 VPIDHGCCLP-------LEWLYTYMCWHLQEIARIPYSQVLLLSIEELDSVNDIETLRVH 455 +PIDHG CLP EWLY W AR+PYS + I+ LD+ DI L+ H Sbjct: 440 IPIDHGYCLPESFEDCTFEWLY----W---PQARVPYSAATIRYIQSLDAEEDIALLQFH 492 Query: 454 AIELPFKSILGFEASTYVLKEGARRKLTPYELG 356 +LP + ST +LK+GA LTP+ +G Sbjct: 493 GWDLPLECARILRISTMLLKKGAELGLTPFAIG 525 >ref|XP_006441081.1| hypothetical protein CICLE_v10019418mg [Citrus clementina] gi|557543343|gb|ESR54321.1| hypothetical protein CICLE_v10019418mg [Citrus clementina] Length = 590 Score = 62.8 bits (151), Expect = 8e-08 Identities = 33/86 (38%), Positives = 46/86 (53%) Frame = -3 Query: 613 VPIDHGCCLPLEWLYTYMCWHLQEIARIPYSQVLLLSIEELDSVNDIETLRVHAIELPFK 434 +PIDHG CLP + W AR PYS + I LD+ DIE L+ H ++P + Sbjct: 448 IPIDHGYCLPYSFEDCTFDWLYWPQARQPYSPETINYINALDAEKDIELLKFHGWDIPPE 507 Query: 433 SILGFEASTYVLKEGARRKLTPYELG 356 ST +LK+G R LTP+++G Sbjct: 508 CARVLRISTMLLKKGVERGLTPFDIG 533 >ref|XP_004965456.1| PREDICTED: probable phosphatidylinositol 4-kinase type 2-beta At1g26270-like [Setaria italica] Length = 571 Score = 62.8 bits (151), Expect = 8e-08 Identities = 43/151 (28%), Positives = 72/151 (47%) Frame = -3 Query: 613 VPIDHGCCLPLEWLYTYMCWHLQEIARIPYSQVLLLSIEELDSVNDIETLRVHAIELPFK 434 +PIDHG CLP ++ W AR P++ + I+ LD+ DI+ L+ H EL + Sbjct: 435 IPIDHGYCLPEKFEDCTFEWLYWPQAREPFNNETIEYIKSLDAEKDIKLLKFHGWELSPR 494 Query: 433 SILGFEASTYVLKEGARRKLTPYELGYFTATTYGQGKRTNSRGRGKASSFCMMLLEIEGR 254 ST +LK+GA R LTPY++G+ + T +RG EIE Sbjct: 495 CARVLRISTMLLKKGAARGLTPYDIGHILC------RETVNRGS-----------EIEDI 537 Query: 253 LKEGGISTVNDKAKGIVKEIADS*LDKYLGE 161 ++E + + ++ + E +D++L + Sbjct: 538 IQEAEDAVLPGSSENMFLETISEIIDRHLNK 568