BLASTX nr result
ID: Paeonia22_contig00033532
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00033532 (254 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006493642.1| PREDICTED: disease resistance protein At4g27... 65 1e-08 >ref|XP_006493642.1| PREDICTED: disease resistance protein At4g27190-like [Citrus sinensis] Length = 1158 Score = 65.1 bits (157), Expect = 1e-08 Identities = 24/43 (55%), Positives = 36/43 (83%) Frame = +3 Query: 126 EDSESSCIIC*KSNHKSKDYYFRCKKCKIPNHF*KDCWHQSKK 254 ++S+S CIIC +SNH+SKD ++C +C+IPNH +DCW+Q+KK Sbjct: 874 KNSDSQCIICNRSNHESKDCRYKCTRCRIPNHSQRDCWYQNKK 916