BLASTX nr result
ID: Paeonia22_contig00033426
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00033426 (241 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB81082.1| Upstream activation factor subunit spp27 [Morus n... 57 3e-06 ref|XP_006373623.1| hypothetical protein POPTR_0016s01500g [Popu... 55 8e-06 ref|XP_007211527.1| hypothetical protein PRUPE_ppa008138mg [Prun... 55 8e-06 >gb|EXB81082.1| Upstream activation factor subunit spp27 [Morus notabilis] Length = 415 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/48 (60%), Positives = 36/48 (75%), Gaps = 3/48 (6%) Frame = -3 Query: 137 MVTDQEIAQALDTVLRDPE---SNPTSLNAVVHQLESKLGFDLTHKVD 3 MVTDQEI+QAL T++R+ T+LN VV QLESKLG+DL+HK D Sbjct: 11 MVTDQEISQALQTLIREASVTGGGVTTLNGVVQQLESKLGYDLSHKAD 58 >ref|XP_006373623.1| hypothetical protein POPTR_0016s01500g [Populus trichocarpa] gi|550320571|gb|ERP51420.1| hypothetical protein POPTR_0016s01500g [Populus trichocarpa] Length = 385 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/44 (65%), Positives = 35/44 (79%), Gaps = 1/44 (2%) Frame = -3 Query: 137 MVTDQEIAQALDTVLRDPE-SNPTSLNAVVHQLESKLGFDLTHK 9 MVTDQEIA+ ++TVLR + S TSLN VV QLE+KLG DL+HK Sbjct: 1 MVTDQEIAKGVETVLRQSDPSTVTSLNGVVQQLEAKLGLDLSHK 44 >ref|XP_007211527.1| hypothetical protein PRUPE_ppa008138mg [Prunus persica] gi|462407392|gb|EMJ12726.1| hypothetical protein PRUPE_ppa008138mg [Prunus persica] Length = 344 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/52 (55%), Positives = 36/52 (69%), Gaps = 7/52 (13%) Frame = -3 Query: 137 MVTDQEIAQALDTVLRDPESNP-------TSLNAVVHQLESKLGFDLTHKVD 3 MVT+QEI+QAL ++ D SNP T+LN VV QLES+LG DL+HK D Sbjct: 1 MVTEQEISQALQALIHDTTSNPNTTTPTFTTLNDVVQQLESRLGLDLSHKTD 52