BLASTX nr result
ID: Paeonia22_contig00033111
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00033111 (285 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003635012.1| PREDICTED: uncharacterized protein LOC100852... 80 3e-13 ref|XP_003635011.1| PREDICTED: uncharacterized protein LOC100852... 80 3e-13 emb|CBI40815.3| unnamed protein product [Vitis vinifera] 80 3e-13 emb|CAN64493.1| hypothetical protein VITISV_001939 [Vitis vinifera] 80 3e-13 ref|XP_003547809.1| PREDICTED: uncharacterized protein LOC100819... 79 8e-13 ref|XP_007201323.1| hypothetical protein PRUPE_ppa007571mg [Prun... 78 1e-12 gb|EXC25118.1| hypothetical protein L484_003042 [Morus notabilis] 77 2e-12 ref|XP_003520924.1| PREDICTED: uncharacterized protein LOC100802... 77 2e-12 ref|XP_006479268.1| PREDICTED: transcriptional regulator ATRX-li... 77 3e-12 ref|XP_006479267.1| PREDICTED: transcriptional regulator ATRX-li... 77 3e-12 ref|XP_006443593.1| hypothetical protein CICLE_v10020442mg [Citr... 77 3e-12 ref|XP_004516309.1| PREDICTED: LON peptidase N-terminal domain a... 77 3e-12 ref|XP_002301791.2| zinc finger family protein [Populus trichoca... 76 4e-12 ref|XP_007049758.1| RING/U-box superfamily protein, putative [Th... 76 4e-12 gb|EYU39196.1| hypothetical protein MIMGU_mgv1a010693mg [Mimulus... 76 5e-12 ref|XP_006356785.1| PREDICTED: uncharacterized protein LOC102589... 76 5e-12 ref|XP_004499519.1| PREDICTED: uncharacterized protein LOC101506... 76 5e-12 ref|XP_004247081.1| PREDICTED: uncharacterized protein LOC101254... 76 5e-12 ref|XP_004139627.1| PREDICTED: uncharacterized protein LOC101222... 75 7e-12 ref|XP_006646612.1| PREDICTED: uncharacterized protein LOC102708... 75 9e-12 >ref|XP_003635012.1| PREDICTED: uncharacterized protein LOC100852917 isoform 2 [Vitis vinifera] gi|359495533|ref|XP_003635013.1| PREDICTED: uncharacterized protein LOC100852917 isoform 3 [Vitis vinifera] Length = 335 Score = 80.1 bits (196), Expect = 3e-13 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 103 YNCCVCMVRHKGAAFIPCGHTFCRLCSRELYVSR 2 YNCCVCMVRHKGAAFIPCGHTFCRLCSREL+VSR Sbjct: 285 YNCCVCMVRHKGAAFIPCGHTFCRLCSRELWVSR 318 >ref|XP_003635011.1| PREDICTED: uncharacterized protein LOC100852917 isoform 1 [Vitis vinifera] Length = 329 Score = 80.1 bits (196), Expect = 3e-13 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 103 YNCCVCMVRHKGAAFIPCGHTFCRLCSRELYVSR 2 YNCCVCMVRHKGAAFIPCGHTFCRLCSREL+VSR Sbjct: 279 YNCCVCMVRHKGAAFIPCGHTFCRLCSRELWVSR 312 >emb|CBI40815.3| unnamed protein product [Vitis vinifera] Length = 317 Score = 80.1 bits (196), Expect = 3e-13 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 103 YNCCVCMVRHKGAAFIPCGHTFCRLCSRELYVSR 2 YNCCVCMVRHKGAAFIPCGHTFCRLCSREL+VSR Sbjct: 267 YNCCVCMVRHKGAAFIPCGHTFCRLCSRELWVSR 300 >emb|CAN64493.1| hypothetical protein VITISV_001939 [Vitis vinifera] Length = 326 Score = 80.1 bits (196), Expect = 3e-13 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 103 YNCCVCMVRHKGAAFIPCGHTFCRLCSRELYVSR 2 YNCCVCMVRHKGAAFIPCGHTFCRLCSREL+VSR Sbjct: 276 YNCCVCMVRHKGAAFIPCGHTFCRLCSRELWVSR 309 >ref|XP_003547809.1| PREDICTED: uncharacterized protein LOC100819018 [Glycine max] Length = 262 Score = 78.6 bits (192), Expect = 8e-13 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -3 Query: 103 YNCCVCMVRHKGAAFIPCGHTFCRLCSRELYVSR 2 YNCCVCMVRHKGAAFIPCGHTFCR+CSRE++VSR Sbjct: 212 YNCCVCMVRHKGAAFIPCGHTFCRMCSREIWVSR 245 >ref|XP_007201323.1| hypothetical protein PRUPE_ppa007571mg [Prunus persica] gi|462396723|gb|EMJ02522.1| hypothetical protein PRUPE_ppa007571mg [Prunus persica] Length = 363 Score = 77.8 bits (190), Expect = 1e-12 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 103 YNCCVCMVRHKGAAFIPCGHTFCRLCSRELYVSR 2 YNCCVCMVRHKGAAFIPCGHTFCR+CSREL+V R Sbjct: 313 YNCCVCMVRHKGAAFIPCGHTFCRMCSRELWVQR 346 >gb|EXC25118.1| hypothetical protein L484_003042 [Morus notabilis] Length = 405 Score = 77.4 bits (189), Expect = 2e-12 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 100 NCCVCMVRHKGAAFIPCGHTFCRLCSRELYVSR 2 NCCVCMVRHKGAAFIPCGHTFCRLCSREL+VSR Sbjct: 356 NCCVCMVRHKGAAFIPCGHTFCRLCSRELWVSR 388 >ref|XP_003520924.1| PREDICTED: uncharacterized protein LOC100802736 [Glycine max] Length = 273 Score = 77.4 bits (189), Expect = 2e-12 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 103 YNCCVCMVRHKGAAFIPCGHTFCRLCSRELYVSR 2 YNCCVCMVRHKGAAFIPCGHTFCR CSRE++VSR Sbjct: 223 YNCCVCMVRHKGAAFIPCGHTFCRTCSREIWVSR 256 >ref|XP_006479268.1| PREDICTED: transcriptional regulator ATRX-like isoform X2 [Citrus sinensis] Length = 375 Score = 76.6 bits (187), Expect = 3e-12 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 103 YNCCVCMVRHKGAAFIPCGHTFCRLCSRELYVSR 2 +NCCVCMVRHKGAAFIPCGHTFCRLCSREL+V R Sbjct: 325 HNCCVCMVRHKGAAFIPCGHTFCRLCSRELWVQR 358 >ref|XP_006479267.1| PREDICTED: transcriptional regulator ATRX-like isoform X1 [Citrus sinensis] Length = 446 Score = 76.6 bits (187), Expect = 3e-12 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 103 YNCCVCMVRHKGAAFIPCGHTFCRLCSRELYVSR 2 +NCCVCMVRHKGAAFIPCGHTFCRLCSREL+V R Sbjct: 396 HNCCVCMVRHKGAAFIPCGHTFCRLCSRELWVQR 429 >ref|XP_006443593.1| hypothetical protein CICLE_v10020442mg [Citrus clementina] gi|557545855|gb|ESR56833.1| hypothetical protein CICLE_v10020442mg [Citrus clementina] Length = 402 Score = 76.6 bits (187), Expect = 3e-12 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 103 YNCCVCMVRHKGAAFIPCGHTFCRLCSRELYVSR 2 +NCCVCMVRHKGAAFIPCGHTFCRLCSREL+V R Sbjct: 352 HNCCVCMVRHKGAAFIPCGHTFCRLCSRELWVQR 385 >ref|XP_004516309.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 2-like [Cicer arietinum] Length = 240 Score = 76.6 bits (187), Expect = 3e-12 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -3 Query: 103 YNCCVCMVRHKGAAFIPCGHTFCRLCSRELYVSR 2 +NCCVCMVRHKGAAFIPCGHTFCR+CSRE++VSR Sbjct: 190 HNCCVCMVRHKGAAFIPCGHTFCRMCSREIWVSR 223 >ref|XP_002301791.2| zinc finger family protein [Populus trichocarpa] gi|550345743|gb|EEE81064.2| zinc finger family protein [Populus trichocarpa] Length = 396 Score = 76.3 bits (186), Expect = 4e-12 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -3 Query: 103 YNCCVCMVRHKGAAFIPCGHTFCRLCSRELYVSR 2 Y CCVCMVRHKGAAFIPCGHTFCRLCSREL+V R Sbjct: 346 YTCCVCMVRHKGAAFIPCGHTFCRLCSRELWVQR 379 >ref|XP_007049758.1| RING/U-box superfamily protein, putative [Theobroma cacao] gi|508702019|gb|EOX93915.1| RING/U-box superfamily protein, putative [Theobroma cacao] Length = 347 Score = 76.3 bits (186), Expect = 4e-12 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -3 Query: 103 YNCCVCMVRHKGAAFIPCGHTFCRLCSRELYVSR 2 Y CCVCMVRHKGAAFIPCGHTFCRLCSREL+V R Sbjct: 297 YTCCVCMVRHKGAAFIPCGHTFCRLCSRELWVQR 330 >gb|EYU39196.1| hypothetical protein MIMGU_mgv1a010693mg [Mimulus guttatus] Length = 305 Score = 75.9 bits (185), Expect = 5e-12 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 100 NCCVCMVRHKGAAFIPCGHTFCRLCSRELYVSR 2 NCCVCMVRHKGAAFIPCGHTFCRLCSREL+V R Sbjct: 256 NCCVCMVRHKGAAFIPCGHTFCRLCSRELWVQR 288 >ref|XP_006356785.1| PREDICTED: uncharacterized protein LOC102589913 [Solanum tuberosum] Length = 255 Score = 75.9 bits (185), Expect = 5e-12 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 100 NCCVCMVRHKGAAFIPCGHTFCRLCSRELYVSR 2 NCCVCMVRHKGAAFIPCGHTFCRLCSREL+V R Sbjct: 206 NCCVCMVRHKGAAFIPCGHTFCRLCSRELWVQR 238 >ref|XP_004499519.1| PREDICTED: uncharacterized protein LOC101506094 [Cicer arietinum] Length = 210 Score = 75.9 bits (185), Expect = 5e-12 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 100 NCCVCMVRHKGAAFIPCGHTFCRLCSRELYVSR 2 NCCVCMVRHKGAAFIPCGHTFCR+CSRE++VSR Sbjct: 161 NCCVCMVRHKGAAFIPCGHTFCRMCSREIWVSR 193 >ref|XP_004247081.1| PREDICTED: uncharacterized protein LOC101254727 [Solanum lycopersicum] Length = 247 Score = 75.9 bits (185), Expect = 5e-12 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 100 NCCVCMVRHKGAAFIPCGHTFCRLCSRELYVSR 2 NCCVCMVRHKGAAFIPCGHTFCRLCSREL+V R Sbjct: 198 NCCVCMVRHKGAAFIPCGHTFCRLCSRELWVQR 230 >ref|XP_004139627.1| PREDICTED: uncharacterized protein LOC101222466 [Cucumis sativus] gi|449475393|ref|XP_004154438.1| PREDICTED: uncharacterized LOC101222466 [Cucumis sativus] Length = 342 Score = 75.5 bits (184), Expect = 7e-12 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 100 NCCVCMVRHKGAAFIPCGHTFCRLCSRELYVSR 2 +CCVCMVRHKGAAFIPCGHTFCRLCSREL+VSR Sbjct: 293 HCCVCMVRHKGAAFIPCGHTFCRLCSRELWVSR 325 >ref|XP_006646612.1| PREDICTED: uncharacterized protein LOC102708770 [Oryza brachyantha] Length = 165 Score = 75.1 bits (183), Expect = 9e-12 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -3 Query: 97 CCVCMVRHKGAAFIPCGHTFCRLCSRELYVSR 2 CCVCMVRHKGAAFIPCGHTFCRLCSREL+VSR Sbjct: 117 CCVCMVRHKGAAFIPCGHTFCRLCSRELWVSR 148