BLASTX nr result
ID: Paeonia22_contig00032746
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00032746 (438 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276573.2| PREDICTED: uncharacterized protein LOC100253... 60 3e-07 >ref|XP_002276573.2| PREDICTED: uncharacterized protein LOC100253614 [Vitis vinifera] Length = 641 Score = 60.1 bits (144), Expect = 3e-07 Identities = 37/85 (43%), Positives = 46/85 (54%), Gaps = 3/85 (3%) Frame = -3 Query: 292 WMDVCEAEQALQKQISLETVTPSLVPSEKNNGVTRRFRPRDVXXXXXXXXXXXXXXXXXX 113 WMDVCEAE+ALQK ++ET LVP+EK NGVTRR + R+V Sbjct: 3 WMDVCEAEKALQKHTAVETSRRPLVPAEKCNGVTRRPKTREVSSRYKSPTPPSTPSGPRR 62 Query: 112 PNAP---RRVNSSSLLAPKRAQSAE 47 +P R V + L KRAQSA+ Sbjct: 63 CGSPNLTRTVPVPAQLVSKRAQSAD 87