BLASTX nr result
ID: Paeonia22_contig00032580
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00032580 (376 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006486600.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_006422433.1| hypothetical protein CICLE_v10027787mg [Citr... 58 2e-06 ref|XP_007041611.1| Pentatricopeptide repeat (PPR) superfamily p... 55 8e-06 gb|EXC31542.1| hypothetical protein L484_006574 [Morus notabilis] 55 1e-05 ref|XP_006384843.1| hypothetical protein POPTR_0004s21560g [Popu... 55 1e-05 >ref|XP_006486600.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140-like [Citrus sinensis] gi|568866524|ref|XP_006486605.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140-like [Citrus sinensis] Length = 889 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/62 (41%), Positives = 41/62 (66%) Frame = +1 Query: 49 TPNTHTYNVLIKVYYLKSEMEDAHNVFGKTSERGRQPNEASFKILICGYCRYELSTKVME 228 +P T+T+N+LI+ +EDA +F K S++G +PNE SF IL+ GYCR L+ + +E Sbjct: 148 SPETYTFNLLIRALCDSGRLEDARKLFDKMSDKGCRPNEFSFAILVRGYCRAGLADEGLE 207 Query: 229 FV 234 + Sbjct: 208 LM 209 >ref|XP_006422433.1| hypothetical protein CICLE_v10027787mg [Citrus clementina] gi|557524367|gb|ESR35673.1| hypothetical protein CICLE_v10027787mg [Citrus clementina] Length = 889 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/62 (41%), Positives = 41/62 (66%) Frame = +1 Query: 49 TPNTHTYNVLIKVYYLKSEMEDAHNVFGKTSERGRQPNEASFKILICGYCRYELSTKVME 228 +P T+T+N+LI+ +EDA +F K S++G +PNE SF IL+ GYCR L+ + +E Sbjct: 148 SPETYTFNLLIRALCDSGRLEDARKLFDKMSDKGCRPNEFSFAILVRGYCRAGLADEGLE 207 Query: 229 FV 234 + Sbjct: 208 LM 209 >ref|XP_007041611.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 1 [Theobroma cacao] gi|508705546|gb|EOX97442.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 1 [Theobroma cacao] Length = 872 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/62 (43%), Positives = 40/62 (64%) Frame = +1 Query: 49 TPNTHTYNVLIKVYYLKSEMEDAHNVFGKTSERGRQPNEASFKILICGYCRYELSTKVME 228 +P T+T+N+LI ++DA +F K SE+G PNE SF IL+ GYCR+ L+ K +E Sbjct: 142 SPQTYTFNLLICGLCDLGHLDDARELFDKMSEKGCVPNEFSFGILVRGYCRFGLADKGVE 201 Query: 229 FV 234 + Sbjct: 202 LL 203 >gb|EXC31542.1| hypothetical protein L484_006574 [Morus notabilis] Length = 864 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/60 (43%), Positives = 37/60 (61%) Frame = +1 Query: 52 PNTHTYNVLIKVYYLKSEMEDAHNVFGKTSERGRQPNEASFKILICGYCRYELSTKVMEF 231 P T+T+N+LI +E+A +F K SE+G +PNE S IL+ GYCR L + +EF Sbjct: 140 PETYTFNLLISALCESGHLENAREMFDKMSEKGCRPNEYSVGILVRGYCRAGLVDEALEF 199 >ref|XP_006384843.1| hypothetical protein POPTR_0004s21560g [Populus trichocarpa] gi|550341611|gb|ERP62640.1| hypothetical protein POPTR_0004s21560g [Populus trichocarpa] Length = 874 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/62 (41%), Positives = 40/62 (64%) Frame = +1 Query: 49 TPNTHTYNVLIKVYYLKSEMEDAHNVFGKTSERGRQPNEASFKILICGYCRYELSTKVME 228 +P T+T+NVLI + ++DA +F K E+G +PNE SF IL+ GYCR ++K +E Sbjct: 144 SPETYTFNVLIGLLCDSGCLDDARELFDKMPEKGCEPNEYSFGILVRGYCRAGFTSKGLE 203 Query: 229 FV 234 + Sbjct: 204 LL 205