BLASTX nr result
ID: Paeonia22_contig00032463
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00032463 (807 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB94180.1| Serine/threonine-protein kinase PRP4-like protein... 57 8e-06 >gb|EXB94180.1| Serine/threonine-protein kinase PRP4-like protein [Morus notabilis] Length = 881 Score = 57.0 bits (136), Expect = 8e-06 Identities = 27/43 (62%), Positives = 31/43 (72%) Frame = +3 Query: 609 KGRDRSEDRDLRWDKERHRSRDREFKMDWRREKELYRSREKEM 737 + RDR DRD R KER RSRDRE DWRREKE RSR++E+ Sbjct: 356 RSRDRDIDRDRRRQKERERSRDRESDRDWRREKERERSRDREL 398