BLASTX nr result
ID: Paeonia22_contig00032311
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00032311 (538 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007292530.1| hypothetical protein MBM_04641 [Marssonina b... 70 2e-10 emb|CCU77132.1| non-classical export protein [Blumeria graminis ... 65 1e-08 gb|EHL00255.1| putative Non-classical export protein 2 [Glarea l... 64 2e-08 gb|EPQ62629.1| hypothetical protein BGT96224_2701 [Blumeria gram... 63 5e-08 gb|ESZ96881.1| putative Non-classical export protein 2 [Scleroti... 60 3e-07 dbj|GAD96894.1| non-classical export protein Nce102, putative [B... 57 3e-06 ref|XP_680952.1| hypothetical protein AN7683.2 [Aspergillus nidu... 56 5e-06 >ref|XP_007292530.1| hypothetical protein MBM_04641 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406864018|gb|EKD17064.1| hypothetical protein MBM_04641 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 169 Score = 70.5 bits (171), Expect = 2e-10 Identities = 34/60 (56%), Positives = 43/60 (71%) Frame = -3 Query: 536 IAGIVLAARLHVHSCGNQSYITSNGLTNGSHHPGRRCHELQXXXXXXXXXXXXFLGSVIL 357 IAGIVLAA+L VHSCGN SY+ SN LTNGS++P +RCHELQ F+GS+++ Sbjct: 84 IAGIVLAAKLDVHSCGNDSYVLSNPLTNGSNNPRKRCHELQASTAFFWFAFAAFVGSLVM 143 >emb|CCU77132.1| non-classical export protein [Blumeria graminis f. sp. hordei DH14] Length = 169 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/60 (48%), Positives = 39/60 (65%) Frame = -3 Query: 536 IAGIVLAARLHVHSCGNQSYITSNGLTNGSHHPGRRCHELQXXXXXXXXXXXXFLGSVIL 357 I G+VLAA+L VHSC ++Y+ SN L NGSH+P +RCHELQ +GS+I+ Sbjct: 84 IVGVVLAAKLRVHSCRKKAYLLSNSLVNGSHNPSKRCHELQAATAFFWFLFLSLVGSLII 143 >gb|EHL00255.1| putative Non-classical export protein 2 [Glarea lozoyensis 74030] gi|512198398|gb|EPE27233.1| hypothetical protein GLAREA_03148 [Glarea lozoyensis ATCC 20868] Length = 169 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -3 Query: 536 IAGIVLAARLHVHSCGNQSYITSNGLTNGSHHPGRRCHELQ 414 IAG+VLAA+L VHSC N+ Y+ +NG TNGSH+P +RC ELQ Sbjct: 84 IAGVVLAAKLTVHSCSNRGYVLTNGYTNGSHNPEKRCRELQ 124 >gb|EPQ62629.1| hypothetical protein BGT96224_2701 [Blumeria graminis f. sp. tritici 96224] Length = 169 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/60 (46%), Positives = 39/60 (65%) Frame = -3 Query: 536 IAGIVLAARLHVHSCGNQSYITSNGLTNGSHHPGRRCHELQXXXXXXXXXXXXFLGSVIL 357 I G+VLA++L VHSC N++Y+ SN L NGSH+P +RC ELQ +GS+I+ Sbjct: 84 IVGVVLASKLRVHSCRNEAYLLSNRLVNGSHNPSKRCRELQAATAFFWFLFVSLVGSLII 143 >gb|ESZ96881.1| putative Non-classical export protein 2 [Sclerotinia borealis F-4157] Length = 164 Score = 60.1 bits (144), Expect = 3e-07 Identities = 34/60 (56%), Positives = 38/60 (63%) Frame = -3 Query: 536 IAGIVLAARLHVHSCGNQSYITSNGLTNGSHHPGRRCHELQXXXXXXXXXXXXFLGSVIL 357 IAGIVLAA+L VHSCGN+ YI SN LT GS H RC ELQ F+GS+IL Sbjct: 83 IAGIVLAAKLGVHSCGNRDYINSNSLTQGSSH---RCRELQAACAFFWFAFVCFVGSLIL 139 >dbj|GAD96894.1| non-classical export protein Nce102, putative [Byssochlamys spectabilis No. 5] Length = 172 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/59 (45%), Positives = 36/59 (61%) Frame = -3 Query: 533 AGIVLAARLHVHSCGNQSYITSNGLTNGSHHPGRRCHELQXXXXXXXXXXXXFLGSVIL 357 +GIVLAARL HSC N+SY+ NG+T SHH +RC E Q ++GS++L Sbjct: 88 SGIVLAARLGAHSCSNRSYLLHNGVTQNSHHREKRCREGQASTAFLWFAWACYMGSLVL 146 >ref|XP_680952.1| hypothetical protein AN7683.2 [Aspergillus nidulans FGSC A4] gi|40742679|gb|EAA61869.1| hypothetical protein AN7683.2 [Aspergillus nidulans FGSC A4] gi|259484024|tpe|CBF79894.1| TPA: non-classical export protein Nce102, putative (AFU_orthologue; AFUA_2G01590) [Aspergillus nidulans FGSC A4] Length = 174 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/40 (60%), Positives = 29/40 (72%) Frame = -3 Query: 533 AGIVLAARLHVHSCGNQSYITSNGLTNGSHHPGRRCHELQ 414 + I LAARL HSC NQ YI +N +TNGSH+P +RC E Q Sbjct: 87 SAIALAARLECHSCSNQEYILNNEITNGSHNPEKRCREAQ 126