BLASTX nr result
ID: Paeonia22_contig00032181
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00032181 (261 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006433232.1| hypothetical protein CICLE_v10001855mg [Citr... 46 6e-06 >ref|XP_006433232.1| hypothetical protein CICLE_v10001855mg [Citrus clementina] gi|568835772|ref|XP_006471933.1| PREDICTED: cinnamoyl-CoA reductase 2-like isoform X1 [Citrus sinensis] gi|568835774|ref|XP_006471934.1| PREDICTED: cinnamoyl-CoA reductase 2-like isoform X2 [Citrus sinensis] gi|557535354|gb|ESR46472.1| hypothetical protein CICLE_v10001855mg [Citrus clementina] Length = 322 Score = 45.8 bits (107), Expect(2) = 6e-06 Identities = 19/36 (52%), Positives = 30/36 (83%) Frame = -1 Query: 207 VELIEPSITGMRNVLNACIMAKVKKFMVMSFVEAVM 100 V+LI+P++ G +NVLN+C+ AKVK+ +V+S + AVM Sbjct: 98 VQLIDPAVVGTKNVLNSCVKAKVKRVVVVSSIGAVM 133 Score = 29.6 bits (65), Expect(2) = 6e-06 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 97 NSNWLKH*FMDDKCWPNTDFFKVIE 23 N NW K MD++CW + +F K E Sbjct: 135 NPNWPKGQVMDEECWSDEEFCKATE 159