BLASTX nr result
ID: Paeonia22_contig00032119
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00032119 (214 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28264.1| hypothetical protein MIMGU_mgv1a008687mg [Mimulus... 64 2e-08 ref|XP_007027116.1| Diaminopimelate epimerase family protein iso... 64 3e-08 ref|XP_007027115.1| Diaminopimelate epimerase family protein iso... 64 3e-08 ref|XP_002278566.1| PREDICTED: diaminopimelate epimerase, chloro... 63 5e-08 ref|XP_006480734.1| PREDICTED: diaminopimelate epimerase, chloro... 62 6e-08 ref|XP_006429008.1| hypothetical protein CICLE_v10012025mg [Citr... 62 6e-08 ref|XP_006429007.1| hypothetical protein CICLE_v10012025mg [Citr... 62 6e-08 emb|CBI32677.3| unnamed protein product [Vitis vinifera] 61 2e-07 ref|XP_006410926.1| hypothetical protein EUTSA_v10016845mg [Eutr... 60 2e-07 ref|XP_002533003.1| Diaminopimelate epimerase, putative [Ricinus... 60 2e-07 ref|XP_007205407.1| hypothetical protein PRUPE_ppa007581mg [Prun... 60 3e-07 gb|EXB67890.1| Diaminopimelate epimerase [Morus notabilis] 59 7e-07 gb|EYU41679.1| hypothetical protein MIMGU_mgv1a008693mg [Mimulus... 58 2e-06 ref|XP_004302726.1| PREDICTED: diaminopimelate epimerase, chloro... 58 2e-06 ref|XP_006345660.1| PREDICTED: diaminopimelate epimerase, chloro... 56 6e-06 ref|NP_190926.1| diaminopimelate epimerase [Arabidopsis thaliana... 55 8e-06 >gb|EYU28264.1| hypothetical protein MIMGU_mgv1a008687mg [Mimulus guttatus] Length = 365 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/48 (62%), Positives = 38/48 (79%) Frame = +3 Query: 69 FQTSLSLSIKAPKKISQTSLLDQRKSGVLDFVKYHNLGNNFILVDNRD 212 F+ S+S +AP+KIS TS D+ +SG+L FVKYH LGN+FILVDNRD Sbjct: 53 FRVCSSISTQAPEKISATSFGDRTESGILHFVKYHGLGNDFILVDNRD 100 >ref|XP_007027116.1| Diaminopimelate epimerase family protein isoform 2 [Theobroma cacao] gi|508715721|gb|EOY07618.1| Diaminopimelate epimerase family protein isoform 2 [Theobroma cacao] Length = 348 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = +3 Query: 84 SLSIKAPKKISQTSLLDQRKSGVLDFVKYHNLGNNFILVDNRD 212 S+SI P KIS TS LD+R+SG + FVKYH LGN+FILVDNRD Sbjct: 54 SMSIGTPDKISTTSFLDRRESGFVHFVKYHGLGNDFILVDNRD 96 >ref|XP_007027115.1| Diaminopimelate epimerase family protein isoform 1 [Theobroma cacao] gi|508715720|gb|EOY07617.1| Diaminopimelate epimerase family protein isoform 1 [Theobroma cacao] Length = 361 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = +3 Query: 84 SLSIKAPKKISQTSLLDQRKSGVLDFVKYHNLGNNFILVDNRD 212 S+SI P KIS TS LD+R+SG + FVKYH LGN+FILVDNRD Sbjct: 54 SMSIGTPDKISTTSFLDRRESGFVHFVKYHGLGNDFILVDNRD 96 >ref|XP_002278566.1| PREDICTED: diaminopimelate epimerase, chloroplastic [Vitis vinifera] Length = 370 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/46 (65%), Positives = 39/46 (84%) Frame = +3 Query: 75 TSLSLSIKAPKKISQTSLLDQRKSGVLDFVKYHNLGNNFILVDNRD 212 ++ S+SI+A +K SQTS LD+++SG L FVKYH LGN+FILVDNRD Sbjct: 60 SATSMSIEALEKGSQTSFLDRKESGFLHFVKYHGLGNDFILVDNRD 105 >ref|XP_006480734.1| PREDICTED: diaminopimelate epimerase, chloroplastic-like [Citrus sinensis] Length = 364 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/51 (60%), Positives = 37/51 (72%) Frame = +3 Query: 60 SFYFQTSLSLSIKAPKKISQTSLLDQRKSGVLDFVKYHNLGNNFILVDNRD 212 SF S SI AP+ S+TS LD+R+SG L FVKYH LGN+FILVDNR+ Sbjct: 48 SFRVSASSMSSIHAPESASRTSFLDRRESGFLHFVKYHGLGNDFILVDNRN 98 >ref|XP_006429008.1| hypothetical protein CICLE_v10012025mg [Citrus clementina] gi|557531065|gb|ESR42248.1| hypothetical protein CICLE_v10012025mg [Citrus clementina] Length = 364 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/51 (60%), Positives = 37/51 (72%) Frame = +3 Query: 60 SFYFQTSLSLSIKAPKKISQTSLLDQRKSGVLDFVKYHNLGNNFILVDNRD 212 SF S SI AP+ S+TS LD+R+SG L FVKYH LGN+FILVDNR+ Sbjct: 48 SFRVSASSMSSIHAPESASRTSFLDRRESGFLHFVKYHGLGNDFILVDNRN 98 >ref|XP_006429007.1| hypothetical protein CICLE_v10012025mg [Citrus clementina] gi|557531064|gb|ESR42247.1| hypothetical protein CICLE_v10012025mg [Citrus clementina] Length = 281 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/51 (60%), Positives = 37/51 (72%) Frame = +3 Query: 60 SFYFQTSLSLSIKAPKKISQTSLLDQRKSGVLDFVKYHNLGNNFILVDNRD 212 SF S SI AP+ S+TS LD+R+SG L FVKYH LGN+FILVDNR+ Sbjct: 48 SFRVSASSMSSIHAPESASRTSFLDRRESGFLHFVKYHGLGNDFILVDNRN 98 >emb|CBI32677.3| unnamed protein product [Vitis vinifera] Length = 307 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = +3 Query: 87 LSIKAPKKISQTSLLDQRKSGVLDFVKYHNLGNNFILVDNRD 212 +SI+A +K SQTS LD+++SG L FVKYH LGN+FILVDNRD Sbjct: 1 MSIEALEKGSQTSFLDRKESGFLHFVKYHGLGNDFILVDNRD 42 >ref|XP_006410926.1| hypothetical protein EUTSA_v10016845mg [Eutrema salsugineum] gi|557112095|gb|ESQ52379.1| hypothetical protein EUTSA_v10016845mg [Eutrema salsugineum] Length = 363 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +3 Query: 84 SLSIKAPKKISQTSLLDQRKSGVLDFVKYHNLGNNFILVDNRD 212 S+S A KIS S LD+R+SGVL FVKYH LGN+FILVDNRD Sbjct: 54 SISAFAADKISPESFLDKRESGVLHFVKYHGLGNDFILVDNRD 96 >ref|XP_002533003.1| Diaminopimelate epimerase, putative [Ricinus communis] gi|223527214|gb|EEF29378.1| Diaminopimelate epimerase, putative [Ricinus communis] Length = 369 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = +3 Query: 75 TSLSLSIKAPKKISQTSLLDQRKSGVLDFVKYHNLGNNFILVDNRD 212 ++ S+S +AP+KIS S LD+R+SG+ FVKY LGN+FILVDNRD Sbjct: 59 SAASMSAEAPEKISTASFLDRRESGIHHFVKYQGLGNDFILVDNRD 104 >ref|XP_007205407.1| hypothetical protein PRUPE_ppa007581mg [Prunus persica] gi|462401049|gb|EMJ06606.1| hypothetical protein PRUPE_ppa007581mg [Prunus persica] Length = 363 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = +3 Query: 78 SLSLSIKAPKKISQTSLLDQRKSGVLDFVKYHNLGNNFILVDNRD 212 S S+S++A +K S S LD+R++G L FVKYH LGN+FILVDNRD Sbjct: 54 SSSMSVEAVEKASPASFLDRRETGFLHFVKYHGLGNDFILVDNRD 98 >gb|EXB67890.1| Diaminopimelate epimerase [Morus notabilis] Length = 359 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/46 (60%), Positives = 36/46 (78%) Frame = +3 Query: 75 TSLSLSIKAPKKISQTSLLDQRKSGVLDFVKYHNLGNNFILVDNRD 212 +S S+++ A +K S S LD+R+SG L FVKYH LGN+FILVDNRD Sbjct: 49 SSSSMTLGAVEKASPVSFLDRRESGFLHFVKYHGLGNDFILVDNRD 94 >gb|EYU41679.1| hypothetical protein MIMGU_mgv1a008693mg [Mimulus guttatus] Length = 365 Score = 57.8 bits (138), Expect = 2e-06 Identities = 31/60 (51%), Positives = 41/60 (68%), Gaps = 1/60 (1%) Frame = +3 Query: 36 IIIRKIGYSFYFQTSLSLSIKAPKKISQTSLLDQRKSG-VLDFVKYHNLGNNFILVDNRD 212 I ++ I F+ +++I +K SQTSLL+ RK G +L FVKYH LGN+FILVDNRD Sbjct: 41 ISLKPIAIKPDFRVFSTMTIHPTEKSSQTSLLNHRKQGQILHFVKYHGLGNDFILVDNRD 100 >ref|XP_004302726.1| PREDICTED: diaminopimelate epimerase, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 362 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = +3 Query: 84 SLSIKAPKKISQTSLLDQRKSGVLDFVKYHNLGNNFILVDNRD 212 S+++ A +K S S LD++++G+L FVKYH LGN+FILVDNRD Sbjct: 55 SMTVGAAEKASPASFLDRKEAGILHFVKYHGLGNDFILVDNRD 97 >ref|XP_006345660.1| PREDICTED: diaminopimelate epimerase, chloroplastic-like [Solanum tuberosum] Length = 363 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/51 (50%), Positives = 34/51 (66%) Frame = +3 Query: 60 SFYFQTSLSLSIKAPKKISQTSLLDQRKSGVLDFVKYHNLGNNFILVDNRD 212 SF S+ I+ P+ S S LD+++S + FVKYH LGN+FILVDNRD Sbjct: 49 SFRISAVSSMKIEVPENSSSASFLDRKESDFVHFVKYHGLGNDFILVDNRD 99 >ref|NP_190926.1| diaminopimelate epimerase [Arabidopsis thaliana] gi|75263858|sp|Q9LFG2.1|DAPF_ARATH RecName: Full=Diaminopimelate epimerase, chloroplastic; Short=DAP epimerase; Flags: Precursor gi|6729509|emb|CAB67665.1| diaminopimelate epimerase-like protein [Arabidopsis thaliana] gi|22022530|gb|AAM83223.1| AT3g53580/F4P12_280 [Arabidopsis thaliana] gi|23505901|gb|AAN28810.1| At3g53580/F4P12_280 [Arabidopsis thaliana] gi|332645592|gb|AEE79113.1| diaminopimelate epimerase [Arabidopsis thaliana] Length = 362 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/51 (50%), Positives = 34/51 (66%) Frame = +3 Query: 60 SFYFQTSLSLSIKAPKKISQTSLLDQRKSGVLDFVKYHNLGNNFILVDNRD 212 S + S+ +K S S LD++++GVL FVKYH LGN+FILVDNRD Sbjct: 47 SLRVSAAASMDAVTAEKFSPASFLDKKETGVLHFVKYHGLGNDFILVDNRD 97