BLASTX nr result
ID: Paeonia22_contig00032100
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00032100 (206 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006469116.1| PREDICTED: uncharacterized protein LOC102612... 88 1e-15 ref|XP_002512799.1| pentatricopeptide repeat-containing protein,... 87 2e-15 ref|XP_007032079.1| Calcium-dependent lipid-binding family prote... 87 2e-15 ref|XP_006387671.1| hypothetical protein POPTR_0689s00200g [Popu... 86 5e-15 ref|XP_006387670.1| hypothetical protein POPTR_0689s00200g [Popu... 86 5e-15 ref|XP_006376231.1| hypothetical protein POPTR_0013s11180g [Popu... 84 2e-14 ref|XP_006446875.1| hypothetical protein CICLE_v10017662mg [Citr... 84 3e-14 ref|XP_002304627.1| hypothetical protein POPTR_0003s15870g [Popu... 82 8e-14 ref|XP_002297893.1| hypothetical protein POPTR_0001s12710g [Popu... 81 2e-13 emb|CBI29284.3| unnamed protein product [Vitis vinifera] 80 3e-13 ref|XP_002268514.1| PREDICTED: uncharacterized protein LOC100245... 80 3e-13 gb|EXC25179.1| hypothetical protein L484_013267 [Morus notabilis] 75 7e-12 ref|XP_002512696.1| conserved hypothetical protein [Ricinus comm... 74 3e-11 ref|XP_007050005.1| Calcium-dependent lipid-binding family prote... 73 4e-11 ref|XP_006478589.1| PREDICTED: uncharacterized protein LOC102631... 72 6e-11 ref|XP_006423839.1| hypothetical protein CICLE_v10028983mg [Citr... 72 6e-11 ref|XP_007227142.1| hypothetical protein PRUPE_ppa026266mg, part... 71 2e-10 ref|XP_004493111.1| PREDICTED: uncharacterized protein LOC101491... 69 7e-10 ref|XP_002278038.2| PREDICTED: uncharacterized protein LOC100244... 67 3e-09 emb|CBI21243.3| unnamed protein product [Vitis vinifera] 67 3e-09 >ref|XP_006469116.1| PREDICTED: uncharacterized protein LOC102612526 [Citrus sinensis] Length = 1508 Score = 87.8 bits (216), Expect = 1e-15 Identities = 41/66 (62%), Positives = 51/66 (77%) Frame = -2 Query: 202 DCDHLFLLFDLRHKGLCFGEETIEEVCVLTEDLIDELNGVARFVSY*LRITDGKPNGVLK 23 DC H+F+ F+L+H+G+ FG++TI EV V +DLI E NGV RFV Y +R DGKPNGVL Sbjct: 1255 DCGHIFVHFELKHEGVMFGDKTIGEVRVPIKDLISEFNGVVRFVDYEVRNPDGKPNGVLT 1314 Query: 22 FSYKVN 5 FSYKVN Sbjct: 1315 FSYKVN 1320 >ref|XP_002512799.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223547810|gb|EEF49302.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 1198 Score = 87.4 bits (215), Expect = 2e-15 Identities = 41/66 (62%), Positives = 51/66 (77%) Frame = -2 Query: 202 DCDHLFLLFDLRHKGLCFGEETIEEVCVLTEDLIDELNGVARFVSY*LRITDGKPNGVLK 23 DCDHLFL FDL H+GL FG +TI +V V +DLI E +G+ RFV+Y +R +GKPNG+L Sbjct: 967 DCDHLFLHFDLLHEGLYFGNKTIGDVRVPLKDLIQESSGITRFVNYQVRSPEGKPNGILN 1026 Query: 22 FSYKVN 5 FSYKVN Sbjct: 1027 FSYKVN 1032 >ref|XP_007032079.1| Calcium-dependent lipid-binding family protein, putative [Theobroma cacao] gi|508711108|gb|EOY03005.1| Calcium-dependent lipid-binding family protein, putative [Theobroma cacao] Length = 309 Score = 87.0 bits (214), Expect = 2e-15 Identities = 42/66 (63%), Positives = 51/66 (77%) Frame = -2 Query: 202 DCDHLFLLFDLRHKGLCFGEETIEEVCVLTEDLIDELNGVARFVSY*LRITDGKPNGVLK 23 DCD+LF+ FDLRH+G+ FG++TI EV V D+I E NGV RFV Y +R TDGK NGVL Sbjct: 77 DCDNLFIHFDLRHEGVMFGDKTIGEVRVPFRDVIQESNGVVRFVIYEVRTTDGKSNGVLN 136 Query: 22 FSYKVN 5 FS+KVN Sbjct: 137 FSFKVN 142 >ref|XP_006387671.1| hypothetical protein POPTR_0689s00200g [Populus trichocarpa] gi|550308095|gb|ERP46585.1| hypothetical protein POPTR_0689s00200g [Populus trichocarpa] Length = 393 Score = 85.9 bits (211), Expect = 5e-15 Identities = 41/65 (63%), Positives = 50/65 (76%) Frame = -2 Query: 202 DCDHLFLLFDLRHKGLCFGEETIEEVCVLTEDLIDELNGVARFVSY*LRITDGKPNGVLK 23 DCDH F+ FDL H+GL FG++TI +V V +DLI E NG+ RF+SY +R DGKPNGVLK Sbjct: 83 DCDHFFIHFDLCHEGLYFGDKTIGKVRVPLKDLIQEANGIVRFLSYEVRTPDGKPNGVLK 142 Query: 22 FSYKV 8 FS KV Sbjct: 143 FSCKV 147 >ref|XP_006387670.1| hypothetical protein POPTR_0689s00200g [Populus trichocarpa] gi|118485775|gb|ABK94736.1| unknown [Populus trichocarpa] gi|550308094|gb|ERP46584.1| hypothetical protein POPTR_0689s00200g [Populus trichocarpa] Length = 311 Score = 85.9 bits (211), Expect = 5e-15 Identities = 41/65 (63%), Positives = 50/65 (76%) Frame = -2 Query: 202 DCDHLFLLFDLRHKGLCFGEETIEEVCVLTEDLIDELNGVARFVSY*LRITDGKPNGVLK 23 DCDH F+ FDL H+GL FG++TI +V V +DLI E NG+ RF+SY +R DGKPNGVLK Sbjct: 83 DCDHFFIHFDLCHEGLYFGDKTIGKVRVPLKDLIQEANGIVRFLSYEVRTPDGKPNGVLK 142 Query: 22 FSYKV 8 FS KV Sbjct: 143 FSCKV 147 >ref|XP_006376231.1| hypothetical protein POPTR_0013s11180g [Populus trichocarpa] gi|550325506|gb|ERP54028.1| hypothetical protein POPTR_0013s11180g [Populus trichocarpa] Length = 309 Score = 84.3 bits (207), Expect = 2e-14 Identities = 40/65 (61%), Positives = 50/65 (76%) Frame = -2 Query: 202 DCDHLFLLFDLRHKGLCFGEETIEEVCVLTEDLIDELNGVARFVSY*LRITDGKPNGVLK 23 DCDH F+ FDL H+GL FG++TI +V V +DLI E NG+ RF+SY +R DGKPNGVLK Sbjct: 83 DCDHFFIHFDLCHEGLYFGDKTIGKVRVPLKDLIQEANGIVRFLSYEVRTPDGKPNGVLK 142 Query: 22 FSYKV 8 FS +V Sbjct: 143 FSCQV 147 >ref|XP_006446875.1| hypothetical protein CICLE_v10017662mg [Citrus clementina] gi|557549486|gb|ESR60115.1| hypothetical protein CICLE_v10017662mg [Citrus clementina] Length = 331 Score = 83.6 bits (205), Expect = 3e-14 Identities = 40/66 (60%), Positives = 50/66 (75%) Frame = -2 Query: 202 DCDHLFLLFDLRHKGLCFGEETIEEVCVLTEDLIDELNGVARFVSY*LRITDGKPNGVLK 23 D H+F+ F+L+H+G+ FG++TI EV V +DLI E NGV RFV Y +R DGKPNGVL Sbjct: 77 DGGHIFVQFELKHEGVMFGDKTIGEVRVPIKDLISEFNGVVRFVDYEVRNPDGKPNGVLT 136 Query: 22 FSYKVN 5 FSYKVN Sbjct: 137 FSYKVN 142 >ref|XP_002304627.1| hypothetical protein POPTR_0003s15870g [Populus trichocarpa] gi|222842059|gb|EEE79606.1| hypothetical protein POPTR_0003s15870g [Populus trichocarpa] Length = 322 Score = 82.0 bits (201), Expect = 8e-14 Identities = 40/64 (62%), Positives = 48/64 (75%) Frame = -2 Query: 196 DHLFLLFDLRHKGLCFGEETIEEVCVLTEDLIDELNGVARFVSY*LRITDGKPNGVLKFS 17 DHLF F+LR KG FG +TI EVCV +DL +E NG RFVSY +R +DG+PNGVL FS Sbjct: 125 DHLFFKFELRCKGSIFGNKTIGEVCVPFKDLNEEFNGSVRFVSYQVRNSDGRPNGVLNFS 184 Query: 16 YKVN 5 Y+VN Sbjct: 185 YEVN 188 >ref|XP_002297893.1| hypothetical protein POPTR_0001s12710g [Populus trichocarpa] gi|222845151|gb|EEE82698.1| hypothetical protein POPTR_0001s12710g [Populus trichocarpa] Length = 350 Score = 80.9 bits (198), Expect = 2e-13 Identities = 39/64 (60%), Positives = 48/64 (75%) Frame = -2 Query: 196 DHLFLLFDLRHKGLCFGEETIEEVCVLTEDLIDELNGVARFVSY*LRITDGKPNGVLKFS 17 DHLF F+LR +G FG ++I EVCV +DLI+E NG RFVSY +R +DGKPNGVL S Sbjct: 148 DHLFFKFELRCEGAIFGNKSIGEVCVPFKDLIEEFNGSVRFVSYQVRNSDGKPNGVLNLS 207 Query: 16 YKVN 5 Y+VN Sbjct: 208 YEVN 211 >emb|CBI29284.3| unnamed protein product [Vitis vinifera] Length = 512 Score = 80.1 bits (196), Expect = 3e-13 Identities = 38/67 (56%), Positives = 49/67 (73%) Frame = -2 Query: 202 DCDHLFLLFDLRHKGLCFGEETIEEVCVLTEDLIDELNGVARFVSY*LRITDGKPNGVLK 23 D + ++ F LR +G+ FG +TI EVCV ++LIDE N RFVSY +R TDGKPNGVL Sbjct: 207 DSANYYVKFSLRCEGIVFGNKTIGEVCVPLKELIDEFNRAVRFVSYQVRTTDGKPNGVLN 266 Query: 22 FSYKVNL 2 FSYK+N+ Sbjct: 267 FSYKLNI 273 >ref|XP_002268514.1| PREDICTED: uncharacterized protein LOC100245456 [Vitis vinifera] Length = 292 Score = 80.1 bits (196), Expect = 3e-13 Identities = 38/67 (56%), Positives = 49/67 (73%) Frame = -2 Query: 202 DCDHLFLLFDLRHKGLCFGEETIEEVCVLTEDLIDELNGVARFVSY*LRITDGKPNGVLK 23 D + ++ F LR +G+ FG +TI EVCV ++LIDE N RFVSY +R TDGKPNGVL Sbjct: 83 DSANYYVKFSLRCEGIVFGNKTIGEVCVPLKELIDEFNRAVRFVSYQVRTTDGKPNGVLN 142 Query: 22 FSYKVNL 2 FSYK+N+ Sbjct: 143 FSYKLNI 149 >gb|EXC25179.1| hypothetical protein L484_013267 [Morus notabilis] Length = 242 Score = 75.5 bits (184), Expect = 7e-12 Identities = 40/70 (57%), Positives = 49/70 (70%), Gaps = 4/70 (5%) Frame = -2 Query: 202 DCDHLFLLFDLRHKGLCFG--EETIEEVCVLTEDLIDEL--NGVARFVSY*LRITDGKPN 35 D DHLF+ DLRH+G+ FG ++TI EV + DL DE NG+ RFV Y +R +DGKPN Sbjct: 79 DLDHLFIHLDLRHEGVLFGIGDKTIGEVRIPLTDLTDEASANGIVRFVRYQVRSSDGKPN 138 Query: 34 GVLKFSYKVN 5 GVLK SYK N Sbjct: 139 GVLKLSYKFN 148 >ref|XP_002512696.1| conserved hypothetical protein [Ricinus communis] gi|223548657|gb|EEF50148.1| conserved hypothetical protein [Ricinus communis] Length = 230 Score = 73.6 bits (179), Expect = 3e-11 Identities = 37/63 (58%), Positives = 46/63 (73%) Frame = -2 Query: 196 DHLFLLFDLRHKGLCFGEETIEEVCVLTEDLIDELNGVARFVSY*LRITDGKPNGVLKFS 17 DHLFL F LR G+ FG+ TI EV V +DLIDE +G RF+SY +R DGKP+GVL FS Sbjct: 76 DHLFLKFKLRCAGVIFGKRTIGEVRVPFKDLIDEYSGTVRFMSYQVRSGDGKPSGVLNFS 135 Query: 16 YKV 8 Y++ Sbjct: 136 YRL 138 >ref|XP_007050005.1| Calcium-dependent lipid-binding family protein, putative [Theobroma cacao] gi|508702266|gb|EOX94162.1| Calcium-dependent lipid-binding family protein, putative [Theobroma cacao] Length = 270 Score = 73.2 bits (178), Expect = 4e-11 Identities = 40/65 (61%), Positives = 47/65 (72%) Frame = -2 Query: 202 DCDHLFLLFDLRHKGLCFGEETIEEVCVLTEDLIDELNGVARFVSY*LRITDGKPNGVLK 23 + D LFL FDLRH+GL TI EV V +DLI+E GV RFVSY +R +DGKPNGVL Sbjct: 79 ETDRLFLKFDLRHEGLV--GRTIGEVRVPLKDLIEEFCGVVRFVSYQVRNSDGKPNGVLN 136 Query: 22 FSYKV 8 FSYK+ Sbjct: 137 FSYKL 141 >ref|XP_006478589.1| PREDICTED: uncharacterized protein LOC102631368 [Citrus sinensis] Length = 281 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/65 (52%), Positives = 45/65 (69%) Frame = -2 Query: 202 DCDHLFLLFDLRHKGLCFGEETIEEVCVLTEDLIDELNGVARFVSY*LRITDGKPNGVLK 23 +C+HLF+ FDL +G+ +G +I +V V +DLIDE NG RFV Y +R GKPNGVL Sbjct: 79 NCNHLFIAFDLYSEGVIYGYRSIGKVHVPLKDLIDEFNGAVRFVRYQIRTGHGKPNGVLS 138 Query: 22 FSYKV 8 F YK+ Sbjct: 139 FCYKL 143 >ref|XP_006423839.1| hypothetical protein CICLE_v10028983mg [Citrus clementina] gi|557525773|gb|ESR37079.1| hypothetical protein CICLE_v10028983mg [Citrus clementina] Length = 288 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/65 (52%), Positives = 45/65 (69%) Frame = -2 Query: 202 DCDHLFLLFDLRHKGLCFGEETIEEVCVLTEDLIDELNGVARFVSY*LRITDGKPNGVLK 23 +C+HLF+ FDL +G+ +G +I +V V +DLIDE NG RFV Y +R GKPNGVL Sbjct: 79 NCNHLFIAFDLYSEGVIYGYRSIGKVHVPLKDLIDEFNGAVRFVRYQIRTGHGKPNGVLS 138 Query: 22 FSYKV 8 F YK+ Sbjct: 139 FCYKL 143 >ref|XP_007227142.1| hypothetical protein PRUPE_ppa026266mg, partial [Prunus persica] gi|462424078|gb|EMJ28341.1| hypothetical protein PRUPE_ppa026266mg, partial [Prunus persica] Length = 297 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/63 (52%), Positives = 47/63 (74%) Frame = -2 Query: 196 DHLFLLFDLRHKGLCFGEETIEEVCVLTEDLIDELNGVARFVSY*LRITDGKPNGVLKFS 17 DHL++ FD+R +G+ FG++++ +V V DL+DE+N RF+SY +R DGKPNGVL FS Sbjct: 58 DHLYVKFDMRCEGILFGKKSLGKVLVPFTDLLDEVNEAVRFLSYQVRTWDGKPNGVLNFS 117 Query: 16 YKV 8 KV Sbjct: 118 SKV 120 >ref|XP_004493111.1| PREDICTED: uncharacterized protein LOC101491643 [Cicer arietinum] Length = 268 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/66 (46%), Positives = 44/66 (66%) Frame = -2 Query: 202 DCDHLFLLFDLRHKGLCFGEETIEEVCVLTEDLIDELNGVARFVSY*LRITDGKPNGVLK 23 D FL F+ RH G+ G++ + E V DLI +++GVARFV+Y +R DGKPNG+ Sbjct: 83 DITDFFLFFEFRHDGVILGDKILGECRVPLSDLIQDVDGVARFVNYEIRSGDGKPNGIFN 142 Query: 22 FSYKVN 5 FSY++N Sbjct: 143 FSYRLN 148 >ref|XP_002278038.2| PREDICTED: uncharacterized protein LOC100244618 [Vitis vinifera] Length = 1154 Score = 66.6 bits (161), Expect = 3e-09 Identities = 37/64 (57%), Positives = 46/64 (71%), Gaps = 3/64 (4%) Frame = -2 Query: 193 HLFLLFDLRHKGLCFG--EETIEEVCVLTEDLID-ELNGVARFVSY*LRITDGKPNGVLK 23 HLF+ FDLR +GL FG ++ + EV V +DLI + NG+ RFVSY +R DGKPNGVL Sbjct: 962 HLFIHFDLRCEGLVFGIGDKALGEVRVPLDDLIQPDSNGIMRFVSYQVRSGDGKPNGVLN 1021 Query: 22 FSYK 11 FSYK Sbjct: 1022 FSYK 1025 >emb|CBI21243.3| unnamed protein product [Vitis vinifera] Length = 778 Score = 66.6 bits (161), Expect = 3e-09 Identities = 37/64 (57%), Positives = 46/64 (71%), Gaps = 3/64 (4%) Frame = -2 Query: 193 HLFLLFDLRHKGLCFG--EETIEEVCVLTEDLID-ELNGVARFVSY*LRITDGKPNGVLK 23 HLF+ FDLR +GL FG ++ + EV V +DLI + NG+ RFVSY +R DGKPNGVL Sbjct: 642 HLFIHFDLRCEGLVFGIGDKALGEVRVPLDDLIQPDSNGIMRFVSYQVRSGDGKPNGVLN 701 Query: 22 FSYK 11 FSYK Sbjct: 702 FSYK 705