BLASTX nr result
ID: Paeonia22_contig00032097
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00032097 (365 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI28179.3| unnamed protein product [Vitis vinifera] 79 5e-13 ref|XP_002285099.1| PREDICTED: probable ethanolamine kinase A [V... 79 5e-13 emb|CAN63497.1| hypothetical protein VITISV_011672 [Vitis vinifera] 79 7e-13 gb|EXB54536.1| putative ethanolamine kinase A [Morus notabilis] 70 4e-10 gb|EYU29782.1| hypothetical protein MIMGU_mgv1a008431mg [Mimulus... 63 4e-08 ref|XP_006450965.1| hypothetical protein CICLE_v10008632mg [Citr... 63 5e-08 ref|XP_006450961.1| hypothetical protein CICLE_v10008632mg [Citr... 63 5e-08 ref|XP_006450960.1| hypothetical protein CICLE_v10008632mg [Citr... 63 5e-08 ref|XP_006450957.1| hypothetical protein CICLE_v10008632mg [Citr... 63 5e-08 ref|XP_006450956.1| hypothetical protein CICLE_v10008632mg [Citr... 63 5e-08 ref|XP_006450955.1| hypothetical protein CICLE_v10008632mg [Citr... 63 5e-08 ref|XP_007202147.1| hypothetical protein PRUPE_ppa007064mg [Prun... 59 7e-07 ref|XP_006578442.1| PREDICTED: probable ethanolamine kinase [Gly... 57 3e-06 ref|XP_003527156.2| PREDICTED: probable ethanolamine kinase-like... 57 3e-06 ref|XP_006408728.1| hypothetical protein EUTSA_v10002015mg [Eutr... 55 8e-06 ref|XP_006408727.1| hypothetical protein EUTSA_v10002015mg [Eutr... 55 8e-06 ref|XP_006408726.1| hypothetical protein EUTSA_v10002015mg [Eutr... 55 8e-06 >emb|CBI28179.3| unnamed protein product [Vitis vinifera] Length = 125 Score = 79.3 bits (194), Expect = 5e-13 Identities = 39/51 (76%), Positives = 42/51 (82%) Frame = +2 Query: 212 MGAVNIWNAMEVAEEARENCDSEIPSSSISVDTSLHLPDMKPRIIELCKDL 364 MGAV IW+AMEVAEEARENC SEI SS +VDTSL P M P+IIELCKDL Sbjct: 1 MGAVKIWDAMEVAEEARENCCSEIHSSHTTVDTSLSFPQMTPKIIELCKDL 51 >ref|XP_002285099.1| PREDICTED: probable ethanolamine kinase A [Vitis vinifera] Length = 377 Score = 79.3 bits (194), Expect = 5e-13 Identities = 39/51 (76%), Positives = 42/51 (82%) Frame = +2 Query: 212 MGAVNIWNAMEVAEEARENCDSEIPSSSISVDTSLHLPDMKPRIIELCKDL 364 MGAV IW+AMEVAEEARENC SEI SS +VDTSL P M P+IIELCKDL Sbjct: 1 MGAVKIWDAMEVAEEARENCCSEIHSSHTTVDTSLSFPQMTPKIIELCKDL 51 >emb|CAN63497.1| hypothetical protein VITISV_011672 [Vitis vinifera] Length = 377 Score = 79.0 bits (193), Expect = 7e-13 Identities = 39/51 (76%), Positives = 42/51 (82%) Frame = +2 Query: 212 MGAVNIWNAMEVAEEARENCDSEIPSSSISVDTSLHLPDMKPRIIELCKDL 364 MGAV IW+AMEVAEEARENC SEI SS +VDTSL P M P+IIELCKDL Sbjct: 1 MGAVKIWDAMEVAEEARENCCSEIHSSHTTVDTSLSFPHMTPKIIELCKDL 51 >gb|EXB54536.1| putative ethanolamine kinase A [Morus notabilis] Length = 384 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/51 (64%), Positives = 39/51 (76%) Frame = +2 Query: 212 MGAVNIWNAMEVAEEARENCDSEIPSSSISVDTSLHLPDMKPRIIELCKDL 364 MGA+NIWNAMEVA EA EN S+I S +S+D SL LP + P +IELCKDL Sbjct: 1 MGALNIWNAMEVASEASENSISQIAFSPLSIDPSLSLPQITPHVIELCKDL 51 >gb|EYU29782.1| hypothetical protein MIMGU_mgv1a008431mg [Mimulus guttatus] Length = 374 Score = 63.2 bits (152), Expect = 4e-08 Identities = 35/52 (67%), Positives = 39/52 (75%), Gaps = 1/52 (1%) Frame = +2 Query: 212 MGAVN-IWNAMEVAEEARENCDSEIPSSSISVDTSLHLPDMKPRIIELCKDL 364 MGA IWNA EVAE SEIPSSS++V+ SL LPDMKPRI+ELCKDL Sbjct: 1 MGATEKIWNATEVAESH----SSEIPSSSLTVNHSLSLPDMKPRIVELCKDL 48 >ref|XP_006450965.1| hypothetical protein CICLE_v10008632mg [Citrus clementina] gi|557554191|gb|ESR64205.1| hypothetical protein CICLE_v10008632mg [Citrus clementina] Length = 257 Score = 62.8 bits (151), Expect = 5e-08 Identities = 34/52 (65%), Positives = 37/52 (71%), Gaps = 1/52 (1%) Frame = +2 Query: 212 MGAVN-IWNAMEVAEEARENCDSEIPSSSISVDTSLHLPDMKPRIIELCKDL 364 MGA IWN MEVA EAREN +E SS + VDTSL LP M PR+I LCKDL Sbjct: 1 MGAAKKIWNEMEVAAEARENGSTEFLSSPLIVDTSLSLPLMTPRVIALCKDL 52 >ref|XP_006450961.1| hypothetical protein CICLE_v10008632mg [Citrus clementina] gi|557554187|gb|ESR64201.1| hypothetical protein CICLE_v10008632mg [Citrus clementina] Length = 360 Score = 62.8 bits (151), Expect = 5e-08 Identities = 34/52 (65%), Positives = 37/52 (71%), Gaps = 1/52 (1%) Frame = +2 Query: 212 MGAVN-IWNAMEVAEEARENCDSEIPSSSISVDTSLHLPDMKPRIIELCKDL 364 MGA IWN MEVA EAREN +E SS + VDTSL LP M PR+I LCKDL Sbjct: 1 MGAAKKIWNEMEVAAEARENGSTEFLSSPLIVDTSLSLPLMTPRVIALCKDL 52 >ref|XP_006450960.1| hypothetical protein CICLE_v10008632mg [Citrus clementina] gi|557554186|gb|ESR64200.1| hypothetical protein CICLE_v10008632mg [Citrus clementina] Length = 238 Score = 62.8 bits (151), Expect = 5e-08 Identities = 34/52 (65%), Positives = 37/52 (71%), Gaps = 1/52 (1%) Frame = +2 Query: 212 MGAVN-IWNAMEVAEEARENCDSEIPSSSISVDTSLHLPDMKPRIIELCKDL 364 MGA IWN MEVA EAREN +E SS + VDTSL LP M PR+I LCKDL Sbjct: 1 MGAAKKIWNEMEVAAEARENGSTEFLSSPLIVDTSLSLPLMTPRVIALCKDL 52 >ref|XP_006450957.1| hypothetical protein CICLE_v10008632mg [Citrus clementina] gi|568843870|ref|XP_006475821.1| PREDICTED: probable ethanolamine kinase-like [Citrus sinensis] gi|557554183|gb|ESR64197.1| hypothetical protein CICLE_v10008632mg [Citrus clementina] Length = 382 Score = 62.8 bits (151), Expect = 5e-08 Identities = 34/52 (65%), Positives = 37/52 (71%), Gaps = 1/52 (1%) Frame = +2 Query: 212 MGAVN-IWNAMEVAEEARENCDSEIPSSSISVDTSLHLPDMKPRIIELCKDL 364 MGA IWN MEVA EAREN +E SS + VDTSL LP M PR+I LCKDL Sbjct: 1 MGAAKKIWNEMEVAAEARENGSTEFLSSPLIVDTSLSLPLMTPRVIALCKDL 52 >ref|XP_006450956.1| hypothetical protein CICLE_v10008632mg [Citrus clementina] gi|567917916|ref|XP_006450964.1| hypothetical protein CICLE_v10008632mg [Citrus clementina] gi|557554182|gb|ESR64196.1| hypothetical protein CICLE_v10008632mg [Citrus clementina] gi|557554190|gb|ESR64204.1| hypothetical protein CICLE_v10008632mg [Citrus clementina] Length = 308 Score = 62.8 bits (151), Expect = 5e-08 Identities = 34/52 (65%), Positives = 37/52 (71%), Gaps = 1/52 (1%) Frame = +2 Query: 212 MGAVN-IWNAMEVAEEARENCDSEIPSSSISVDTSLHLPDMKPRIIELCKDL 364 MGA IWN MEVA EAREN +E SS + VDTSL LP M PR+I LCKDL Sbjct: 1 MGAAKKIWNEMEVAAEARENGSTEFLSSPLIVDTSLSLPLMTPRVIALCKDL 52 >ref|XP_006450955.1| hypothetical protein CICLE_v10008632mg [Citrus clementina] gi|567917906|ref|XP_006450959.1| hypothetical protein CICLE_v10008632mg [Citrus clementina] gi|567917914|ref|XP_006450963.1| hypothetical protein CICLE_v10008632mg [Citrus clementina] gi|557554181|gb|ESR64195.1| hypothetical protein CICLE_v10008632mg [Citrus clementina] gi|557554185|gb|ESR64199.1| hypothetical protein CICLE_v10008632mg [Citrus clementina] gi|557554189|gb|ESR64203.1| hypothetical protein CICLE_v10008632mg [Citrus clementina] Length = 282 Score = 62.8 bits (151), Expect = 5e-08 Identities = 34/52 (65%), Positives = 37/52 (71%), Gaps = 1/52 (1%) Frame = +2 Query: 212 MGAVN-IWNAMEVAEEARENCDSEIPSSSISVDTSLHLPDMKPRIIELCKDL 364 MGA IWN MEVA EAREN +E SS + VDTSL LP M PR+I LCKDL Sbjct: 1 MGAAKKIWNEMEVAAEARENGSTEFLSSPLIVDTSLSLPLMTPRVIALCKDL 52 >ref|XP_007202147.1| hypothetical protein PRUPE_ppa007064mg [Prunus persica] gi|462397678|gb|EMJ03346.1| hypothetical protein PRUPE_ppa007064mg [Prunus persica] Length = 384 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/50 (60%), Positives = 36/50 (72%) Frame = +2 Query: 215 GAVNIWNAMEVAEEARENCDSEIPSSSISVDTSLHLPDMKPRIIELCKDL 364 G NIWNAMEVA++ + S+I SSS+SVD SL L + P IIELCKDL Sbjct: 3 GVKNIWNAMEVAKQTSDCSTSQIHSSSLSVDPSLPLSHITPLIIELCKDL 52 >ref|XP_006578442.1| PREDICTED: probable ethanolamine kinase [Glycine max] Length = 378 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/52 (53%), Positives = 39/52 (75%), Gaps = 1/52 (1%) Frame = +2 Query: 212 MGA-VNIWNAMEVAEEARENCDSEIPSSSISVDTSLHLPDMKPRIIELCKDL 364 MGA V IWN +EVAE+AR + S+I SS +++D SL LP M P +++LCKD+ Sbjct: 1 MGAEVKIWNPVEVAEQARHDYASQIHSSHLTIDPSLELPLMAPLVLKLCKDM 52 >ref|XP_003527156.2| PREDICTED: probable ethanolamine kinase-like [Glycine max] Length = 476 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/52 (51%), Positives = 38/52 (73%), Gaps = 1/52 (1%) Frame = +2 Query: 212 MGA-VNIWNAMEVAEEARENCDSEIPSSSISVDTSLHLPDMKPRIIELCKDL 364 MGA V IWN +EVAE+AR + S+I S +++D SL LP M P +++LCKD+ Sbjct: 96 MGAEVKIWNPVEVAEQARHDYASQIHPSHLTIDPSLELPQMTPLVLKLCKDM 147 >ref|XP_006408728.1| hypothetical protein EUTSA_v10002015mg [Eutrema salsugineum] gi|557109884|gb|ESQ50181.1| hypothetical protein EUTSA_v10002015mg [Eutrema salsugineum] Length = 378 Score = 55.5 bits (132), Expect = 8e-06 Identities = 32/54 (59%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 212 MGAV-NIWNAMEVAEEA--RENCDSEIPSSSISVDTSLHLPDMKPRIIELCKDL 364 MGA NIW +E ++A N S+IP SSI V+TSL LP M PRIIELCKDL Sbjct: 1 MGAAKNIWAILEAEDDASGNNNASSQIPYSSIIVNTSLPLPVMIPRIIELCKDL 54 >ref|XP_006408727.1| hypothetical protein EUTSA_v10002015mg [Eutrema salsugineum] gi|557109883|gb|ESQ50180.1| hypothetical protein EUTSA_v10002015mg [Eutrema salsugineum] Length = 361 Score = 55.5 bits (132), Expect = 8e-06 Identities = 32/54 (59%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 212 MGAV-NIWNAMEVAEEA--RENCDSEIPSSSISVDTSLHLPDMKPRIIELCKDL 364 MGA NIW +E ++A N S+IP SSI V+TSL LP M PRIIELCKDL Sbjct: 1 MGAAKNIWAILEAEDDASGNNNASSQIPYSSIIVNTSLPLPVMIPRIIELCKDL 54 >ref|XP_006408726.1| hypothetical protein EUTSA_v10002015mg [Eutrema salsugineum] gi|557109882|gb|ESQ50179.1| hypothetical protein EUTSA_v10002015mg [Eutrema salsugineum] Length = 282 Score = 55.5 bits (132), Expect = 8e-06 Identities = 32/54 (59%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +2 Query: 212 MGAV-NIWNAMEVAEEA--RENCDSEIPSSSISVDTSLHLPDMKPRIIELCKDL 364 MGA NIW +E ++A N S+IP SSI V+TSL LP M PRIIELCKDL Sbjct: 1 MGAAKNIWAILEAEDDASGNNNASSQIPYSSIIVNTSLPLPVMIPRIIELCKDL 54