BLASTX nr result
ID: Paeonia22_contig00031874
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00031874 (241 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006848166.1| hypothetical protein AMTR_s00029p00234880 [A... 70 4e-10 ref|XP_007218949.1| hypothetical protein PRUPE_ppa003426mg [Prun... 68 1e-09 ref|XP_004160746.1| PREDICTED: anthranilate synthase component I... 68 1e-09 ref|XP_004138565.1| PREDICTED: anthranilate synthase component I... 68 1e-09 ref|XP_003559222.1| PREDICTED: anthranilate synthase component I... 67 2e-09 ref|XP_003635982.1| Anthranilate synthase alpha [Medicago trunca... 67 2e-09 ref|XP_003601171.1| Anthranilate synthase alpha [Medicago trunca... 67 2e-09 ref|XP_003600871.1| Anthranilate synthase alpha [Medicago trunca... 67 2e-09 gb|EXB58194.1| Anthranilate synthase component I-1 [Morus notabi... 67 3e-09 ref|XP_002316223.2| hypothetical protein POPTR_0010s19790g [Popu... 67 3e-09 ref|XP_004500675.1| PREDICTED: anthranilate synthase component I... 67 3e-09 gb|AGJ70267.1| anthranilate synthase A [Vitis labrusca] 67 3e-09 gb|AGJ70266.1| anthranilate synthase A [Vitis vinifera] 67 3e-09 gb|AFR69323.1| anthranilate synthase alpha 1 [Oryza sativa] gi|4... 67 3e-09 gb|ACY29654.1| anthranilate synthase 01 [Vitis vinifera] 67 3e-09 ref|XP_002279476.1| PREDICTED: anthranilate synthase component I... 67 3e-09 emb|CAN83610.1| hypothetical protein VITISV_035611 [Vitis vinifera] 67 3e-09 ref|XP_006488497.1| PREDICTED: anthranilate synthase component I... 66 4e-09 gb|AFL91701.1| anthranilate synthase alpha-subunit 2 [Mitragyna ... 66 6e-09 ref|XP_006651978.1| PREDICTED: anthranilate synthase component I... 65 8e-09 >ref|XP_006848166.1| hypothetical protein AMTR_s00029p00234880 [Amborella trichopoda] gi|548851471|gb|ERN09747.1| hypothetical protein AMTR_s00029p00234880 [Amborella trichopoda] Length = 579 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/51 (60%), Positives = 38/51 (74%) Frame = +3 Query: 3 GPYSGGLRIISYSGDMHIAIALKTIIFPTGSHFNIMYSYKDASNHDEMSTH 155 GPYSGG IS+SGD+ IA+AL+TI+FP G H++ MYSYKDAS E H Sbjct: 488 GPYSGGFGGISFSGDLDIALALRTIVFPMGKHYDTMYSYKDASRRREWVAH 538 >ref|XP_007218949.1| hypothetical protein PRUPE_ppa003426mg [Prunus persica] gi|462415411|gb|EMJ20148.1| hypothetical protein PRUPE_ppa003426mg [Prunus persica] Length = 575 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/51 (58%), Positives = 38/51 (74%) Frame = +3 Query: 3 GPYSGGLRIISYSGDMHIAIALKTIIFPTGSHFNIMYSYKDASNHDEMSTH 155 GPYSGG +S+SGDM IA+AL+T++F TGS F+ +YSYKDAS E H Sbjct: 484 GPYSGGFGAVSFSGDMDIALALRTMVFTTGSRFDTLYSYKDASQRREWVAH 534 >ref|XP_004160746.1| PREDICTED: anthranilate synthase component I-1, chloroplastic-like [Cucumis sativus] Length = 532 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/51 (54%), Positives = 38/51 (74%) Frame = +3 Query: 3 GPYSGGLRIISYSGDMHIAIALKTIIFPTGSHFNIMYSYKDASNHDEMSTH 155 GPYSGG +S++GDM IA+AL+TI+FPT +H++ MYSYKD + E H Sbjct: 441 GPYSGGFGTVSFNGDMDIALALRTIVFPTSAHYDTMYSYKDVNQRREWIAH 491 >ref|XP_004138565.1| PREDICTED: anthranilate synthase component I-1, chloroplastic-like [Cucumis sativus] Length = 532 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/51 (54%), Positives = 38/51 (74%) Frame = +3 Query: 3 GPYSGGLRIISYSGDMHIAIALKTIIFPTGSHFNIMYSYKDASNHDEMSTH 155 GPYSGG +S++GDM IA+AL+TI+FPT +H++ MYSYKD + E H Sbjct: 441 GPYSGGFGTVSFNGDMDIALALRTIVFPTSAHYDTMYSYKDVNQRREWIAH 491 >ref|XP_003559222.1| PREDICTED: anthranilate synthase component I-1, chloroplastic-like [Brachypodium distachyon] Length = 616 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/51 (60%), Positives = 37/51 (72%) Frame = +3 Query: 3 GPYSGGLRIISYSGDMHIAIALKTIIFPTGSHFNIMYSYKDASNHDEMSTH 155 GPYSGG IS+ GDM IA+AL+TI+FPTGS F+ MYSY D+S E H Sbjct: 520 GPYSGGFGGISFRGDMDIALALRTIVFPTGSRFDTMYSYADSSARQEWVAH 570 >ref|XP_003635982.1| Anthranilate synthase alpha [Medicago truncatula] gi|355501917|gb|AES83120.1| Anthranilate synthase alpha [Medicago truncatula] Length = 1359 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = +3 Query: 3 GPYSGGLRIISYSGDMHIAIALKTIIFPTGSHFNIMYSYKDASNHDE 143 GPYSGG IS+SGDM IA+AL+TI+FPTG+ ++ MYSYKD + E Sbjct: 1268 GPYSGGFGYISFSGDMDIALALRTIVFPTGTRYDTMYSYKDLNKRQE 1314 >ref|XP_003601171.1| Anthranilate synthase alpha [Medicago truncatula] gi|355490219|gb|AES71422.1| Anthranilate synthase alpha [Medicago truncatula] Length = 604 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = +3 Query: 3 GPYSGGLRIISYSGDMHIAIALKTIIFPTGSHFNIMYSYKDASNHDE 143 GPYSGG IS+SGDM IA+AL+TI+FPTG+ ++ MYSYKD + E Sbjct: 513 GPYSGGFGYISFSGDMDIALALRTIVFPTGTRYDTMYSYKDLNKRQE 559 >ref|XP_003600871.1| Anthranilate synthase alpha [Medicago truncatula] gi|355489919|gb|AES71122.1| Anthranilate synthase alpha [Medicago truncatula] Length = 602 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = +3 Query: 3 GPYSGGLRIISYSGDMHIAIALKTIIFPTGSHFNIMYSYKDASNHDE 143 GPYSGG IS+SGDM IA+AL+TI+FPTG+ ++ MYSYKD + E Sbjct: 511 GPYSGGFGYISFSGDMDIALALRTIVFPTGTRYDTMYSYKDLNKRQE 557 >gb|EXB58194.1| Anthranilate synthase component I-1 [Morus notabilis] Length = 581 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = +3 Query: 3 GPYSGGLRIISYSGDMHIAIALKTIIFPTGSHFNIMYSYKDASNHDE 143 GPYSGG +S++GDM IA+AL+TI+FPTG+ F+ MYSYKDA E Sbjct: 490 GPYSGGFGGVSFTGDMDIALALRTIVFPTGTRFDTMYSYKDAGGRRE 536 >ref|XP_002316223.2| hypothetical protein POPTR_0010s19790g [Populus trichocarpa] gi|550330186|gb|EEF02394.2| hypothetical protein POPTR_0010s19790g [Populus trichocarpa] Length = 580 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/42 (66%), Positives = 37/42 (88%) Frame = +3 Query: 3 GPYSGGLRIISYSGDMHIAIALKTIIFPTGSHFNIMYSYKDA 128 GPYSGGL +S++GDM IA+AL+T++FPTG+ +N MYSYKDA Sbjct: 488 GPYSGGLGGVSFTGDMDIALALRTMVFPTGTQYNTMYSYKDA 529 >ref|XP_004500675.1| PREDICTED: anthranilate synthase component I-1, chloroplastic-like [Cicer arietinum] Length = 601 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = +3 Query: 3 GPYSGGLRIISYSGDMHIAIALKTIIFPTGSHFNIMYSYKDASNHDE 143 GPYSGG IS+SGDM IA+AL+TI+FPTG+ ++ MYSYKD + E Sbjct: 510 GPYSGGFGYISFSGDMDIALALRTIVFPTGTRYDTMYSYKDLNQRRE 556 >gb|AGJ70267.1| anthranilate synthase A [Vitis labrusca] Length = 611 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/51 (58%), Positives = 38/51 (74%) Frame = +3 Query: 3 GPYSGGLRIISYSGDMHIAIALKTIIFPTGSHFNIMYSYKDASNHDEMSTH 155 GPYSGG IS+SGDM IA+AL+TI+FP+GS F+ M+SYKD + E H Sbjct: 520 GPYSGGFGGISFSGDMDIALALRTIVFPSGSRFDTMFSYKDMNKRREWVAH 570 >gb|AGJ70266.1| anthranilate synthase A [Vitis vinifera] Length = 608 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/51 (58%), Positives = 38/51 (74%) Frame = +3 Query: 3 GPYSGGLRIISYSGDMHIAIALKTIIFPTGSHFNIMYSYKDASNHDEMSTH 155 GPYSGG IS+SGDM IA+AL+TI+FP+GS F+ M+SYKD + E H Sbjct: 517 GPYSGGFGGISFSGDMDIALALRTIVFPSGSRFDTMFSYKDMNKRREWVAH 567 >gb|AFR69323.1| anthranilate synthase alpha 1 [Oryza sativa] gi|404435982|gb|AFR69325.1| anthranilate synthase alpha 1 [Oryza sativa] Length = 577 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/51 (58%), Positives = 36/51 (70%) Frame = +3 Query: 3 GPYSGGLRIISYSGDMHIAIALKTIIFPTGSHFNIMYSYKDASNHDEMSTH 155 GPYSGG +SY GDM IA+AL+TI+FPTGS F+ MYSY D + E H Sbjct: 486 GPYSGGFGGVSYRGDMDIALALRTIVFPTGSRFDTMYSYTDKNARQEWVAH 536 >gb|ACY29654.1| anthranilate synthase 01 [Vitis vinifera] Length = 192 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/51 (58%), Positives = 38/51 (74%) Frame = +3 Query: 3 GPYSGGLRIISYSGDMHIAIALKTIIFPTGSHFNIMYSYKDASNHDEMSTH 155 GPYSGG IS+SGDM IA+AL+TI+FP+GS F+ M+SYKD + E H Sbjct: 101 GPYSGGFGGISFSGDMDIALALRTIVFPSGSRFDTMFSYKDMNKRREWVAH 151 >ref|XP_002279476.1| PREDICTED: anthranilate synthase component I-2, chloroplastic-like [Vitis vinifera] Length = 622 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/51 (58%), Positives = 38/51 (74%) Frame = +3 Query: 3 GPYSGGLRIISYSGDMHIAIALKTIIFPTGSHFNIMYSYKDASNHDEMSTH 155 GPYSGG IS+SGDM IA+AL+TI+FP+GS F+ M+SYKD + E H Sbjct: 531 GPYSGGFGGISFSGDMDIALALRTIVFPSGSRFDTMFSYKDMNKRREWVAH 581 >emb|CAN83610.1| hypothetical protein VITISV_035611 [Vitis vinifera] Length = 601 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/51 (58%), Positives = 38/51 (74%) Frame = +3 Query: 3 GPYSGGLRIISYSGDMHIAIALKTIIFPTGSHFNIMYSYKDASNHDEMSTH 155 GPYSGG IS+SGDM IA+AL+TI+FP+GS F+ M+SYKD + E H Sbjct: 510 GPYSGGFGGISFSGDMDIALALRTIVFPSGSRFDTMFSYKDMNKRREWVAH 560 >ref|XP_006488497.1| PREDICTED: anthranilate synthase component I-2, chloroplastic-like [Citrus sinensis] Length = 596 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/51 (56%), Positives = 37/51 (72%) Frame = +3 Query: 3 GPYSGGLRIISYSGDMHIAIALKTIIFPTGSHFNIMYSYKDASNHDEMSTH 155 GPYSGG IS++GDM IA+AL+TI+FPT + ++ MYSYKD N E H Sbjct: 505 GPYSGGFGGISFTGDMDIALALRTIVFPTATRYDTMYSYKDVDNRREWIAH 555 >gb|AFL91701.1| anthranilate synthase alpha-subunit 2 [Mitragyna speciosa] Length = 575 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/51 (56%), Positives = 37/51 (72%) Frame = +3 Query: 3 GPYSGGLRIISYSGDMHIAIALKTIIFPTGSHFNIMYSYKDASNHDEMSTH 155 GPYSGG IS+SGDM +A+AL+TI+FPTG+ ++ MYSYKD E H Sbjct: 484 GPYSGGFGGISFSGDMDVALALRTIVFPTGTRYDTMYSYKDEIKRREWIAH 534 >ref|XP_006651978.1| PREDICTED: anthranilate synthase component I-1, chloroplastic-like [Oryza brachyantha] Length = 557 Score = 65.5 bits (158), Expect = 8e-09 Identities = 30/51 (58%), Positives = 36/51 (70%) Frame = +3 Query: 3 GPYSGGLRIISYSGDMHIAIALKTIIFPTGSHFNIMYSYKDASNHDEMSTH 155 GPYSGG IS+ GDM IA+AL+TI+FPTGS F+ MYSY D + E H Sbjct: 466 GPYSGGFGGISFRGDMDIALALRTIVFPTGSRFDTMYSYTDKNARQEWVAH 516