BLASTX nr result
ID: Paeonia22_contig00031736
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00031736 (280 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002264772.1| PREDICTED: ATPase family AAA domain-containi... 93 3e-17 ref|XP_007034085.1| Cell division cycle protein 48-related / CDC... 81 2e-13 ref|XP_007034084.1| Cell division cycle protein 48-related / CDC... 81 2e-13 ref|XP_007034083.1| Cell division cycle protein 48-related / CDC... 81 2e-13 emb|CBI36654.3| unnamed protein product [Vitis vinifera] 80 2e-13 ref|XP_002533048.1| ATP binding protein, putative [Ricinus commu... 80 4e-13 ref|XP_002309811.1| cell division cycle protein 48 [Populus tric... 77 3e-12 ref|XP_006372883.1| cell division cycle protein 48 [Populus tric... 76 6e-12 ref|XP_006443050.1| hypothetical protein CICLE_v10018558mg [Citr... 75 7e-12 gb|EXB68718.1| ATPase family AAA domain-containing protein [Moru... 74 3e-11 ref|XP_006590944.1| PREDICTED: ATPase family AAA domain-containi... 67 2e-09 ref|XP_003537941.1| PREDICTED: ATPase family AAA domain-containi... 67 2e-09 ref|XP_006592155.1| PREDICTED: ATPase family AAA domain-containi... 66 4e-09 ref|XP_003541174.1| PREDICTED: ATPase family AAA domain-containi... 66 4e-09 ref|XP_003636952.1| ATPase family AAA domain-containing protein ... 66 4e-09 ref|XP_007131957.1| hypothetical protein PHAVU_011G054900g [Phas... 64 3e-08 ref|XP_007227367.1| hypothetical protein PRUPE_ppa000349mg [Prun... 63 4e-08 ref|XP_006338077.1| PREDICTED: ATPase family AAA domain-containi... 60 3e-07 ref|XP_004507330.1| PREDICTED: ATPase family AAA domain-containi... 59 5e-07 ref|XP_006858683.1| hypothetical protein AMTR_s00066p00084950 [A... 59 9e-07 >ref|XP_002264772.1| PREDICTED: ATPase family AAA domain-containing protein 2B-like [Vitis vinifera] Length = 1218 Score = 93.2 bits (230), Expect = 3e-17 Identities = 44/61 (72%), Positives = 52/61 (85%) Frame = -2 Query: 279 NSVSQDDIPSPKRKKVLQAKSLPRREGLRPRGSRQVAREPLNLESDNERETSEEKIGHDE 100 NS SQD++ SPK KK+L A+ LPRREGLRPR S+ VARE LNLESD+E+ TSEEK+GHDE Sbjct: 123 NSASQDELSSPKHKKILDARPLPRREGLRPRRSKAVAREQLNLESDDEQGTSEEKVGHDE 182 Query: 99 T 97 T Sbjct: 183 T 183 >ref|XP_007034085.1| Cell division cycle protein 48-related / CDC48-related isoform 3 [Theobroma cacao] gi|508713114|gb|EOY05011.1| Cell division cycle protein 48-related / CDC48-related isoform 3 [Theobroma cacao] Length = 1015 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/61 (60%), Positives = 48/61 (78%) Frame = -2 Query: 279 NSVSQDDIPSPKRKKVLQAKSLPRREGLRPRGSRQVAREPLNLESDNERETSEEKIGHDE 100 NSVSQD+ PSPKRKK ++ K PRREGLRPR S+ A + +NL+ +E++TSEEK+G DE Sbjct: 122 NSVSQDEFPSPKRKKTMETKETPRREGLRPRRSKAAAIKRMNLDFGDEQDTSEEKVGEDE 181 Query: 99 T 97 T Sbjct: 182 T 182 >ref|XP_007034084.1| Cell division cycle protein 48-related / CDC48-related isoform 2 [Theobroma cacao] gi|508713113|gb|EOY05010.1| Cell division cycle protein 48-related / CDC48-related isoform 2 [Theobroma cacao] Length = 1207 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/61 (60%), Positives = 48/61 (78%) Frame = -2 Query: 279 NSVSQDDIPSPKRKKVLQAKSLPRREGLRPRGSRQVAREPLNLESDNERETSEEKIGHDE 100 NSVSQD+ PSPKRKK ++ K PRREGLRPR S+ A + +NL+ +E++TSEEK+G DE Sbjct: 122 NSVSQDEFPSPKRKKTMETKETPRREGLRPRRSKAAAIKRMNLDFGDEQDTSEEKVGEDE 181 Query: 99 T 97 T Sbjct: 182 T 182 >ref|XP_007034083.1| Cell division cycle protein 48-related / CDC48-related isoform 1 [Theobroma cacao] gi|508713112|gb|EOY05009.1| Cell division cycle protein 48-related / CDC48-related isoform 1 [Theobroma cacao] Length = 1208 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/61 (60%), Positives = 48/61 (78%) Frame = -2 Query: 279 NSVSQDDIPSPKRKKVLQAKSLPRREGLRPRGSRQVAREPLNLESDNERETSEEKIGHDE 100 NSVSQD+ PSPKRKK ++ K PRREGLRPR S+ A + +NL+ +E++TSEEK+G DE Sbjct: 122 NSVSQDEFPSPKRKKTMETKETPRREGLRPRRSKAAAIKRMNLDFGDEQDTSEEKVGEDE 181 Query: 99 T 97 T Sbjct: 182 T 182 >emb|CBI36654.3| unnamed protein product [Vitis vinifera] Length = 1105 Score = 80.5 bits (197), Expect = 2e-13 Identities = 39/55 (70%), Positives = 46/55 (83%) Frame = -2 Query: 279 NSVSQDDIPSPKRKKVLQAKSLPRREGLRPRGSRQVAREPLNLESDNERETSEEK 115 NS SQD++ SPK KK+L A+ LPRREGLRPR S+ VARE LNLESD+E+ TSEEK Sbjct: 123 NSASQDELSSPKHKKILDARPLPRREGLRPRRSKAVAREQLNLESDDEQGTSEEK 177 >ref|XP_002533048.1| ATP binding protein, putative [Ricinus communis] gi|223527167|gb|EEF29338.1| ATP binding protein, putative [Ricinus communis] Length = 1153 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/61 (62%), Positives = 49/61 (80%) Frame = -2 Query: 279 NSVSQDDIPSPKRKKVLQAKSLPRREGLRPRGSRQVAREPLNLESDNERETSEEKIGHDE 100 NSVSQD++ SPKRKK+ + +S PRREGLRPR S+ +ARE LNLES +E++T + KI DE Sbjct: 122 NSVSQDELSSPKRKKIAETRSTPRREGLRPRRSKTLAREKLNLESGDEQDTFDNKIIEDE 181 Query: 99 T 97 T Sbjct: 182 T 182 >ref|XP_002309811.1| cell division cycle protein 48 [Populus trichocarpa] gi|222852714|gb|EEE90261.1| cell division cycle protein 48 [Populus trichocarpa] Length = 1219 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/61 (60%), Positives = 47/61 (77%) Frame = -2 Query: 279 NSVSQDDIPSPKRKKVLQAKSLPRREGLRPRGSRQVAREPLNLESDNERETSEEKIGHDE 100 NS SQD++ S KRKK ++ KS PRREGLRPR SR + ++PL LES +E++TSEEK DE Sbjct: 120 NSASQDELSSSKRKKNVETKSTPRREGLRPRRSRTIIKKPLTLESGDEQDTSEEKAVQDE 179 Query: 99 T 97 T Sbjct: 180 T 180 >ref|XP_006372883.1| cell division cycle protein 48 [Populus trichocarpa] gi|550319531|gb|ERP50680.1| cell division cycle protein 48 [Populus trichocarpa] Length = 1203 Score = 75.9 bits (185), Expect = 6e-12 Identities = 36/61 (59%), Positives = 47/61 (77%) Frame = -2 Query: 279 NSVSQDDIPSPKRKKVLQAKSLPRREGLRPRGSRQVAREPLNLESDNERETSEEKIGHDE 100 NS SQD++ S KRK++++ KS PRREGLRPR SR + EPL L+S +E++TSEEK DE Sbjct: 120 NSASQDELSSSKRKQIVETKSTPRREGLRPRRSRTIKTEPLALDSGDEQDTSEEKAVEDE 179 Query: 99 T 97 T Sbjct: 180 T 180 >ref|XP_006443050.1| hypothetical protein CICLE_v10018558mg [Citrus clementina] gi|568849918|ref|XP_006478682.1| PREDICTED: ATPase family AAA domain-containing protein At1g05910-like [Citrus sinensis] gi|557545312|gb|ESR56290.1| hypothetical protein CICLE_v10018558mg [Citrus clementina] Length = 1205 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/61 (59%), Positives = 47/61 (77%) Frame = -2 Query: 279 NSVSQDDIPSPKRKKVLQAKSLPRREGLRPRGSRQVAREPLNLESDNERETSEEKIGHDE 100 N++SQD++ KRKKV++AK PRREGLRPR S R+ LNL+S +E+ TSEEK+G DE Sbjct: 120 NNMSQDELSPSKRKKVVEAKPTPRREGLRPRRSMVATRKQLNLDSGDEQGTSEEKVGQDE 179 Query: 99 T 97 T Sbjct: 180 T 180 >gb|EXB68718.1| ATPase family AAA domain-containing protein [Morus notabilis] Length = 1229 Score = 73.6 bits (179), Expect = 3e-11 Identities = 37/61 (60%), Positives = 47/61 (77%) Frame = -2 Query: 279 NSVSQDDIPSPKRKKVLQAKSLPRREGLRPRGSRQVAREPLNLESDNERETSEEKIGHDE 100 N+VS+ ++ SPK KKV++ KS PRREGLRPR S+ V RE N+E D+ + TSEEKIG DE Sbjct: 135 NNVSRVELLSPKNKKVVENKSTPRREGLRPRRSKGVPREQSNMELDDGQGTSEEKIGEDE 194 Query: 99 T 97 T Sbjct: 195 T 195 >ref|XP_006590944.1| PREDICTED: ATPase family AAA domain-containing protein At1g05910-like isoform X3 [Glycine max] Length = 1195 Score = 67.4 bits (163), Expect = 2e-09 Identities = 34/61 (55%), Positives = 43/61 (70%) Frame = -2 Query: 279 NSVSQDDIPSPKRKKVLQAKSLPRREGLRPRGSRQVAREPLNLESDNERETSEEKIGHDE 100 NSV +D + S KRK+ + K PRREGLRPR S+ A E L LESD+E++ SEEK+ DE Sbjct: 122 NSVRRDGLMSNKRKRAAETKQTPRREGLRPRRSKGAAIERLILESDDEQDLSEEKVDEDE 181 Query: 99 T 97 T Sbjct: 182 T 182 >ref|XP_003537941.1| PREDICTED: ATPase family AAA domain-containing protein At1g05910-like isoform X1 [Glycine max] gi|571488458|ref|XP_006590943.1| PREDICTED: ATPase family AAA domain-containing protein At1g05910-like isoform X2 [Glycine max] Length = 1196 Score = 67.4 bits (163), Expect = 2e-09 Identities = 34/61 (55%), Positives = 43/61 (70%) Frame = -2 Query: 279 NSVSQDDIPSPKRKKVLQAKSLPRREGLRPRGSRQVAREPLNLESDNERETSEEKIGHDE 100 NSV +D + S KRK+ + K PRREGLRPR S+ A E L LESD+E++ SEEK+ DE Sbjct: 122 NSVRRDGLMSNKRKRAAETKQTPRREGLRPRRSKGAAIERLILESDDEQDLSEEKVDEDE 181 Query: 99 T 97 T Sbjct: 182 T 182 >ref|XP_006592155.1| PREDICTED: ATPase family AAA domain-containing protein At1g05910-like isoform X2 [Glycine max] Length = 1200 Score = 66.2 bits (160), Expect = 4e-09 Identities = 34/61 (55%), Positives = 43/61 (70%) Frame = -2 Query: 279 NSVSQDDIPSPKRKKVLQAKSLPRREGLRPRGSRQVAREPLNLESDNERETSEEKIGHDE 100 NS +D + S KRK+V + K PRREGLRPR S+ A E L LESD+E++ SEEK+ DE Sbjct: 122 NSDRRDGLMSNKRKRVAETKQTPRREGLRPRRSKGAAIERLILESDDEQDLSEEKVDQDE 181 Query: 99 T 97 T Sbjct: 182 T 182 >ref|XP_003541174.1| PREDICTED: ATPase family AAA domain-containing protein At1g05910-like isoform X1 [Glycine max] Length = 1201 Score = 66.2 bits (160), Expect = 4e-09 Identities = 34/61 (55%), Positives = 43/61 (70%) Frame = -2 Query: 279 NSVSQDDIPSPKRKKVLQAKSLPRREGLRPRGSRQVAREPLNLESDNERETSEEKIGHDE 100 NS +D + S KRK+V + K PRREGLRPR S+ A E L LESD+E++ SEEK+ DE Sbjct: 122 NSDRRDGLMSNKRKRVAETKQTPRREGLRPRRSKGAAIERLILESDDEQDLSEEKVDQDE 181 Query: 99 T 97 T Sbjct: 182 T 182 >ref|XP_003636952.1| ATPase family AAA domain-containing protein 2B, partial [Medicago truncatula] gi|355502887|gb|AES84090.1| ATPase family AAA domain-containing protein 2B, partial [Medicago truncatula] Length = 843 Score = 66.2 bits (160), Expect = 4e-09 Identities = 34/61 (55%), Positives = 43/61 (70%) Frame = -2 Query: 279 NSVSQDDIPSPKRKKVLQAKSLPRREGLRPRGSRQVAREPLNLESDNERETSEEKIGHDE 100 NSVS+DD S KRK+ + AK PRREGLRPR S+ RE L ESD++++ SE K+ DE Sbjct: 122 NSVSRDDAISSKRKRGVDAKPTPRREGLRPRRSKAAGRERLISESDDDQDLSEGKVEQDE 181 Query: 99 T 97 T Sbjct: 182 T 182 >ref|XP_007131957.1| hypothetical protein PHAVU_011G054900g [Phaseolus vulgaris] gi|561004957|gb|ESW03951.1| hypothetical protein PHAVU_011G054900g [Phaseolus vulgaris] Length = 1193 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/61 (52%), Positives = 40/61 (65%) Frame = -2 Query: 279 NSVSQDDIPSPKRKKVLQAKSLPRREGLRPRGSRQVAREPLNLESDNERETSEEKIGHDE 100 N V QD + S KRK+ + K PRREGLRPR S+ E L ESD+E++ SEEK+ DE Sbjct: 121 NRVKQDGLMSSKRKRAAETKPTPRREGLRPRRSKGAVIERLISESDDEQDLSEEKVDQDE 180 Query: 99 T 97 T Sbjct: 181 T 181 >ref|XP_007227367.1| hypothetical protein PRUPE_ppa000349mg [Prunus persica] gi|462424303|gb|EMJ28566.1| hypothetical protein PRUPE_ppa000349mg [Prunus persica] Length = 1258 Score = 63.2 bits (152), Expect = 4e-08 Identities = 32/61 (52%), Positives = 43/61 (70%) Frame = -2 Query: 279 NSVSQDDIPSPKRKKVLQAKSLPRREGLRPRGSRQVAREPLNLESDNERETSEEKIGHDE 100 NS +D+ SPK KK+L+ + PRREGLRPR + +RE L L D+E++TSEEKI +E Sbjct: 135 NSACKDEPSSPKHKKILETRQTPRREGLRPRRLKS-SREQLVLRFDDEQDTSEEKIDQEE 193 Query: 99 T 97 T Sbjct: 194 T 194 >ref|XP_006338077.1| PREDICTED: ATPase family AAA domain-containing protein At1g05910-like isoform X1 [Solanum tuberosum] gi|565341839|ref|XP_006338078.1| PREDICTED: ATPase family AAA domain-containing protein At1g05910-like isoform X2 [Solanum tuberosum] Length = 1194 Score = 60.1 bits (144), Expect = 3e-07 Identities = 32/60 (53%), Positives = 43/60 (71%) Frame = -2 Query: 279 NSVSQDDIPSPKRKKVLQAKSLPRREGLRPRGSRQVAREPLNLESDNERETSEEKIGHDE 100 NS SQDD+ P+R+ + PRR GLRPR +R V R+ LNL SD+E++TS+EKIG D+ Sbjct: 123 NSASQDDL-MPRREGLR-----PRRAGLRPRRARAVGRQQLNLRSDDEQDTSDEKIGQDD 176 >ref|XP_004507330.1| PREDICTED: ATPase family AAA domain-containing protein At1g05910-like [Cicer arietinum] Length = 1202 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/61 (49%), Positives = 40/61 (65%) Frame = -2 Query: 279 NSVSQDDIPSPKRKKVLQAKSLPRREGLRPRGSRQVAREPLNLESDNERETSEEKIGHDE 100 NSVS+DD+ S KRK+ + K PRREGLRPR + ESD++++ SEEK+ DE Sbjct: 122 NSVSRDDVISSKRKRGGETKPTPRREGLRPRXXXXXXXXXIISESDDDQDLSEEKVEQDE 181 Query: 99 T 97 T Sbjct: 182 T 182 >ref|XP_006858683.1| hypothetical protein AMTR_s00066p00084950 [Amborella trichopoda] gi|548862794|gb|ERN20150.1| hypothetical protein AMTR_s00066p00084950 [Amborella trichopoda] Length = 1205 Score = 58.5 bits (140), Expect = 9e-07 Identities = 32/61 (52%), Positives = 41/61 (67%), Gaps = 1/61 (1%) Frame = -2 Query: 279 NSVSQDDIPSP-KRKKVLQAKSLPRREGLRPRGSRQVAREPLNLESDNERETSEEKIGHD 103 N+ S DD +P +RKK K LPRREGLRPR S ARE L ES++++E+SEE+ D Sbjct: 114 NNASHDDFSTPPRRKKSPVNKYLPRREGLRPRRSTTAAREQLFQESEDDQESSEERADQD 173 Query: 102 E 100 E Sbjct: 174 E 174